Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate WP_011607007.1 FRAAL_RS25905 homoserine kinase
Query= curated2:Q9ADB2 (309 letters) >NCBI__GCF_000058485.1:WP_011607007.1 Length = 371 Score = 249 bits (636), Expect = 7e-71 Identities = 160/363 (44%), Positives = 198/363 (54%), Gaps = 63/363 (17%) Query: 2 AGPAFRAAAVRVRVPATSANLGPGFDALGLALGLYDDVVVRVADSGLHIDIAGEGSETLP 61 AG A VRVRVPATSANLGPGFDA GLALGLYD+V V + SGL +D+ G + + Sbjct: 7 AGADGAARRVRVRVPATSANLGPGFDAFGLALGLYDEVDVEMTASGLTVDVVGP--DEVA 64 Query: 62 RDEKHLLVRSLRTAFDLLGGQPRGLEIVCANRIPHGRGLGSSSAAICAGIVAARAVT--- 118 +DE HL+VR++R FDLLG GL + C NRIPHGRGLGSS+AAI AGIVAA A+ Sbjct: 65 QDETHLVVRAIRATFDLLGRPQPGLALRCVNRIPHGRGLGSSAAAIVAGIVAAAALDRPD 124 Query: 119 IGGEARLDDAA------------------------------------------------- 129 +G E AA Sbjct: 125 LGPEFEAGPAANQGDPGVARPGVPADRAATATAAGPAAAAGPGPGDSAGPATSVPAAAAW 184 Query: 130 LLDLATEIEGHPDNVAACLLGGFTLSWMESGAARAIRMEPSDSIVPVVFVPGKPVLTQTA 189 +L LA +IEGHPDNVAA L GGFT++W + AR +R++P + PVVFVP T+ + Sbjct: 185 MLRLAHDIEGHPDNVAAALSGGFTVAWQDVEGARCLRVDPFAELRPVVFVPTVRQSTEAS 244 Query: 190 RGLLPRSVPHVDAAANAGRAALLV--------EALTRRPELLLPATEDRLHQEYRAPAMP 241 RG LP V DAA GRAALL A +R L ATED LHQ YR PA P Sbjct: 245 RGALPVLVGLPDAARTLGRAALLALTMSAAEPAAAAQRARTLFSATEDLLHQPYRLPAAP 304 Query: 242 ESTALVERLRGDGIPAVISGAGPTVMALA-DADTADKVEALAGTDWAANRLGLDQQGATV 300 + LV RLR G+PA +SG+GP+V+ALA + A A +++ L +D+ GA V Sbjct: 305 ATGELVARLRALGVPATLSGSGPSVLALAVGGEQAAAAVGAASAEFSVAPLSVDRSGAQV 364 Query: 301 LPL 303 L Sbjct: 365 TRL 367 Lambda K H 0.318 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 309 Length of database: 371 Length adjustment: 28 Effective length of query: 281 Effective length of database: 343 Effective search space: 96383 Effective search space used: 96383 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory