Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_011610577.1 TERY_RS03605 inositol monophosphatase
Query= curated2:P56160 (259 letters) >NCBI__GCF_000014265.1:WP_011610577.1 Length = 274 Score = 108 bits (269), Expect = 2e-28 Identities = 77/243 (31%), Positives = 115/243 (47%), Gaps = 8/243 (3%) Query: 5 LQLALELAEKAGKLTLDYFGRRSLQVFSKRDDTP--VTEADRNAEELIRQGISAKFPDDG 62 L +A E A G + Y+G +LQ ++ VTEAD+ AEE+I + + P+ G Sbjct: 10 LDIATEAALAGGAELISYWG--NLQNIQEKGSPGNLVTEADKAAEEVIIKVLQRHLPEHG 67 Query: 63 LFGEEFDEHPSGNGRR-WIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALGE 121 + EE E S R W IDP+DGT +F H P + L ++G Q+GV+ P L E Sbjct: 68 ILSEEAGELGSRKSRYLWAIDPLDGTTNFAHQYPFSASSVGLLIDGVPQVGVVFNPILEE 127 Query: 122 LYQAERGSGAFMNGSPVQVSAIAENSASTVV---FTEKEYLLDPPSNHPVDQLRIDAGLV 178 L++A +G GA N P+ VS S V+ ++ D + G+ Sbjct: 128 LFRAAKGLGATRNRKPISVSKTTTLQKSLVITGFAYDRRETTDNNYKEFCQMCHLTQGVR 187 Query: 179 RGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEGLV 238 R Y +A GRA+ ++ +SPWD AA I ++EEAGG Y I ++ Sbjct: 188 RSGCASYDLSSIACGRADGYWERGLSPWDIAAGIVVLEEAGGKVTAYNSSPFDIKSGKIL 247 Query: 239 SAN 241 + N Sbjct: 248 ATN 250 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 274 Length adjustment: 25 Effective length of query: 234 Effective length of database: 249 Effective search space: 58266 Effective search space used: 58266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory