Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_011610965.1 TERY_RS05770 cysteine synthase A
Query= BRENDA::A8YBS4 (319 letters) >NCBI__GCF_000014265.1:WP_011610965.1 Length = 320 Score = 475 bits (1223), Expect = e-139 Identities = 235/312 (75%), Positives = 274/312 (87%), Gaps = 1/312 (0%) Query: 1 MRIAHDVTELVGRTPLVQLNRIPQAEGCLGRIVMKLEGMNPAASVKDRIGTHMINSAEKA 60 MRIAH++TELVGRTPLVQLN IP+AEGCL +I++KLEGMNPAASVKDRIG +MIN AE+ Sbjct: 1 MRIAHNITELVGRTPLVQLNSIPKAEGCLAKIIVKLEGMNPAASVKDRIGVNMINVAERE 60 Query: 61 GLINPETTVLVEPTSGNTGIALAMTAAAKGYRLILTMPETMSLERRAMLKAYGATLELTP 120 GLI P T LVEPTSGNTGIALAM AAA+GY+LILTMPETMS+ERR ML+AYGA L LTP Sbjct: 61 GLIKPGKTTLVEPTSGNTGIALAMVAAARGYKLILTMPETMSMERRVMLRAYGAELVLTP 120 Query: 121 GSQGMKGAILRAQQIVD-SIPGAYMLQQFRNPSNPEIHRLTTAEEIWQDTEGQVDFIVAG 179 GS+GMKGAI +AQ+IVD S G YMLQQF+NP+NPEIH TTA EIW+DT+G+VD +VAG Sbjct: 121 GSEGMKGAITKAQEIVDLSSNGYYMLQQFQNPANPEIHSKTTALEIWEDTDGKVDILVAG 180 Query: 180 VGTGGTITGVAEVIKSRKPSFQVVAVEPFNSPVISGGNPGPHKIQGIGAGFIPEVLRTDL 239 VGTGGT+TGVAE IK+RKP FQ +AVEP NSPV+SGG PGPHKIQGIGAGF+P+VL T + Sbjct: 181 VGTGGTVTGVAETIKARKPEFQAIAVEPSNSPVLSGGKPGPHKIQGIGAGFVPDVLDTKI 240 Query: 240 IDEVITVSDEEAFQFGRRLAKEEGLLSGISSGANLCAAIQLAQRPENEGKLIVVIQPSFG 299 IDEVI V D EA +GRR+AKEEG+LSGIS+GA LCAAI++ +RPEN+GKLIV+IQPSFG Sbjct: 241 IDEVIQVPDSEAMVYGRRIAKEEGILSGISTGAALCAAIEVGKRPENDGKLIVMIQPSFG 300 Query: 300 ERYLSTLMFQNI 311 ERYLST +FQ + Sbjct: 301 ERYLSTPLFQEL 312 Lambda K H 0.317 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 320 Length adjustment: 28 Effective length of query: 291 Effective length of database: 292 Effective search space: 84972 Effective search space used: 84972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_011610965.1 TERY_RS05770 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.27510.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-147 475.0 1.3 5e-147 474.9 1.3 1.0 1 lcl|NCBI__GCF_000014265.1:WP_011610965.1 TERY_RS05770 cysteine synthase A Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000014265.1:WP_011610965.1 TERY_RS05770 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 474.9 1.3 5e-147 5e-147 1 298 [] 7 309 .. 7 309 .. 0.99 Alignments for each domain: == domain 1 score: 474.9 bits; conditional E-value: 5e-147 TIGR01139 1 iseliGntPlvrLn...laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgk.tiveats 65 i+el+G+tPlv+Ln ae++ a+++vkle +nP++svkdri+++mi+ ae+egl+k+gk t+ve+ts lcl|NCBI__GCF_000014265.1:WP_011610965.1 7 ITELVGRTPLVQLNsipKAEGCLAKIIVKLEGMNPAASVKDRIGVNMINVAEREGLIKPGKtTLVEPTS 75 689***********877789999*************************************989****** PP TIGR01139 66 GntGialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkyl 134 GntGialamvaaargykliltmpetms+err +l+ayGaelvLt+g+egmkgai+ka+e+v+ ++n y+ lcl|NCBI__GCF_000014265.1:WP_011610965.1 76 GNTGIALAMVAAARGYKLILTMPETMSMERRVMLRAYGAELVLTPGSEGMKGAITKAQEIVDLSSNGYY 144 ********************************************************************* PP TIGR01139 135 llkqfenpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespv 203 +l+qf+npanpeih ktta ei++d+dgk+d++vagvGtGGt+tGv+e++k kp+++++aveP++spv lcl|NCBI__GCF_000014265.1:WP_011610965.1 145 MLQQFQNPANPEIHSKTTALEIWEDTDGKVDILVAGVGTGGTVTGVAETIKARKPEFQAIAVEPSNSPV 213 ********************************************************************* PP TIGR01139 204 lsggkpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkva 272 lsggkpgphkiqGigagf+P+vLd+++idevi+v d ea+ ++rr+akeeGil+Gis+Gaa+ aa++v lcl|NCBI__GCF_000014265.1:WP_011610965.1 214 LSGGKPGPHKIQGIGAGFVPDVLDTKIIDEVIQVPDSEAMVYGRRIAKEEGILSGISTGAALCAAIEVG 282 ********************************************************************* PP TIGR01139 273 kkle.kdkkivvilpdtgerYlstaLf 298 k++e ++k+iv+i+p++gerYlst+Lf lcl|NCBI__GCF_000014265.1:WP_011610965.1 283 KRPEnDGKLIVMIQPSFGERYLSTPLF 309 ****899*******************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (320 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 9.35 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory