GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cmutase in Trichodesmium erythraeum IMS101

Align Chorismate mutase AroH; CM; EC 5.4.99.5 (characterized)
to candidate WP_011612064.1 TERY_RS11905 chorismate mutase

Query= SwissProt::P19080
         (127 letters)



>NCBI__GCF_000014265.1:WP_011612064.1
          Length = 125

 Score = 82.4 bits (202), Expect = 2e-21
 Identities = 43/118 (36%), Positives = 67/118 (56%), Gaps = 1/118 (0%)

Query: 3   IRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAV 62
           ++ IRGATTV  ++ E I +   +LL ++ ++N    E V+    S T DL A+FPA   
Sbjct: 5   VQAIRGATTVSENSVEAIREAVNELLNELEKKNDFDLEQVISATFSVTHDLDAIFPAAIA 64

Query: 63  RELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTV-QTDVPQDQIRHVYLEKVVVLRPDL 119
           R+   W  +P+  +Q+M V G LK+CIR ++ +   +    +I H YL +   LRPDL
Sbjct: 65  RQRPNWNNIPLLDVQQMYVKGSLKRCIRFLIYINMPEANPKKIVHTYLREAKNLRPDL 122


Lambda     K      H
   0.318    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 52
Number of extensions: 4
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 127
Length of database: 125
Length adjustment: 14
Effective length of query: 113
Effective length of database: 111
Effective search space:    12543
Effective search space used:    12543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 41 (20.4 bits)

Align candidate WP_011612064.1 TERY_RS11905 (chorismate mutase)
to HMM TIGR01796 (aroH: chorismate mutase (EC 5.4.99.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01796.hmm
# target sequence database:        /tmp/gapView.4668.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01796  [M=117]
Accession:   TIGR01796
Description: CM_mono_aroH: chorismate mutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    2.1e-48  149.8   0.1    2.4e-48  149.6   0.1    1.0  1  lcl|NCBI__GCF_000014265.1:WP_011612064.1  TERY_RS11905 chorismate mutase


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000014265.1:WP_011612064.1  TERY_RS11905 chorismate mutase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.6   0.1   2.4e-48   2.4e-48       1     117 []       5     122 ..       5     122 .. 0.97

  Alignments for each domain:
  == domain 1  score: 149.6 bits;  conditional E-value: 2.4e-48
                                 TIGR01796   1 lravrGattveaneaeeileaveeLleellerneltaedlisviltvteDlsaafPakavrelaGiedv 69 
                                               ++a+rGattv++n++e+i+eav+eLl+el+++n+ + e++is +++vt+Dl+a+fPa+++r+++ ++++
  lcl|NCBI__GCF_000014265.1:WP_011612064.1   5 VQAIRGATTVSENSVEAIREAVNELLNELEKKNDFDLEQVISATFSVTHDLDAIFPAAIARQRPNWNNI 73 
                                               68******************************************************************* PP

                                 TIGR01796  70 pvlcaqeldvegslercirvlihiesekar.seiahvyLreakkLrpDl 117
                                               p+l++q++ v+gsl+rcir+li+i++ +a+  +i h yLreak+LrpDl
  lcl|NCBI__GCF_000014265.1:WP_011612064.1  74 PLLDVQQMYVKGSLKRCIRFLIYINMPEANpKKIVHTYLREAKNLRPDL 122
                                               *************************97765378***************7 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (117 nodes)
Target sequences:                          1  (125 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 5.40
//
[ok]

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory