Align phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (characterized)
to candidate WP_011612285.1 TERY_RS13135 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
Query= reanno::Korea:Ga0059261_1051 (107 letters) >NCBI__GCF_000014265.1:WP_011612285.1 Length = 219 Score = 66.2 bits (160), Expect = 2e-16 Identities = 38/90 (42%), Positives = 50/90 (55%) Query: 3 ADILDTLEAVIRERRTGDPATSYVAKLTAKGRAKIAQKLGEEAVEAAIAAVQDDRDGLTG 62 ADIL L VIR+RR SY +L A G KI +K+GEE+ E +A D ++ + Sbjct: 125 ADILSQLFDVIRDRRDHPQEGSYTCQLFAGGDNKILKKIGEESAEVVMACKDDHKESIAA 184 Query: 63 EAADLIFHLLVLLADTGLSLDDVRAELARR 92 E ADL +H LV LA + L DV +L R Sbjct: 185 EVADLFYHTLVTLAYHNVELRDVYRKLDER 214 Lambda K H 0.315 0.132 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 47 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 107 Length of database: 219 Length adjustment: 17 Effective length of query: 90 Effective length of database: 202 Effective search space: 18180 Effective search space used: 18180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_011612285.1 TERY_RS13135 (bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE)
to HMM TIGR03188 (hisE: phosphoribosyl-ATP diphosphatase (EC 3.6.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03188.hmm # target sequence database: /tmp/gapView.12288.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03188 [M=84] Accession: TIGR03188 Description: histidine_hisI: phosphoribosyl-ATP diphosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-35 107.7 0.0 2.1e-35 107.1 0.0 1.3 1 lcl|NCBI__GCF_000014265.1:WP_011612285.1 TERY_RS13135 bifunctional phosph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000014265.1:WP_011612285.1 TERY_RS13135 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl- # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.1 0.0 2.1e-35 2.1e-35 1 84 [] 128 211 .. 128 211 .. 0.99 Alignments for each domain: == domain 1 score: 107.1 bits; conditional E-value: 2.1e-35 TIGR03188 1 leeLeevieerkeedpeeSytakllekgedkilkKvgEEavEviiaaknedkeelveEaaDllYhllVl 69 l++L++vi++r+++++e+Syt +l++ g++kilkK+gEE++Ev++a+k+++ke+++ E+aDl+Yh+lV+ lcl|NCBI__GCF_000014265.1:WP_011612285.1 128 LSQLFDVIRDRRDHPQEGSYTCQLFAGGDNKILKKIGEESAEVVMACKDDHKESIAAEVADLFYHTLVT 196 789****************************************************************** PP TIGR03188 70 laekgvsledvlaeL 84 la+++v+l+dv+++L lcl|NCBI__GCF_000014265.1:WP_011612285.1 197 LAYHNVELRDVYRKL 211 ************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (84 nodes) Target sequences: 1 (219 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.83 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory