Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_011612642.1 TERY_RS15180 alanine--glyoxylate aminotransferase family protein
Query= BRENDA::P74281 (384 letters) >NCBI__GCF_000014265.1:WP_011612642.1 Length = 385 Score = 545 bits (1403), Expect = e-159 Identities = 270/384 (70%), Positives = 317/384 (82%), Gaps = 1/384 (0%) Query: 1 MDNKQMLMIPGPTPVPEKVLLAMAKHPIGHRSGDFSKIIAELTANLKWLHQTENDVLMLT 60 MD+K MLMIPGPTPVPE LLAMAKHPIGHRSGDFSKI+AE+T NLKWLHQT+ND+L+L Sbjct: 1 MDDKLMLMIPGPTPVPETALLAMAKHPIGHRSGDFSKIMAEVTENLKWLHQTKNDMLILA 60 Query: 61 TSGTGAMEASIINFLSPGDRVLVGNNGKFGDRWVKVAKTFGLAVEEIKAEWGKALDPNDF 120 +SGTGAMEA IINFLSPGDRVL G NGKFGDRW +VA +GL VE+I AEWGKAL+ F Sbjct: 61 SSGTGAMEAGIINFLSPGDRVLCGCNGKFGDRWAEVATAYGLQVEKITAEWGKALETEKF 120 Query: 121 KTLLEADSDKTIKALIITHSETSTGVLNDLAAINAAAKAHGGALMIVDAVTSLGATPVAI 180 + LEAD DK IKA+I+THSETSTGVLNDL IN KAHG AL+IVDAVTSLGA + + Sbjct: 121 RQHLEADKDKQIKAVILTHSETSTGVLNDLETINGYVKAHGEALIIVDAVTSLGAVSIPV 180 Query: 181 DDLGLDVVASGSQKGYMIPPGLGFVSVSAKAWQAYETATIPRFYLDLKKYKKSTDEDSSP 240 D+LGLDVVASGSQKGYMIPPGL FV+V KAW AYETA +PR+YLDL KY+K ++++P Sbjct: 181 DELGLDVVASGSQKGYMIPPGLAFVAVGPKAWTAYETAKLPRYYLDLGKYRKDAAKNTTP 240 Query: 241 FTPPINLMYGLQASLQMMKAEGLDAIFTRHQRHTNATRGAMKALNLPLFAPDNAASNAIT 300 FTPP+NL + LQA+L++M+AEGL+ IF RH R +ATR A+KAL LPL A D AS A+T Sbjct: 241 FTPPVNLFFALQATLRIMQAEGLENIFARHDRLKSATRAAIKALGLPLLASDKVASPAVT 300 Query: 301 AVA-PLGVEAEKIRSTMRKKFDIAMAGGQDHLKGKIFRIGHLGFVCDRDILSCIGALEAT 359 AVA P VEAEK+R+ M+K+FDIA+AGGQDHLKGKIFRIGHLGFVC+RD+ S I ALE T Sbjct: 301 AVAPPTEVEAEKVRAIMKKRFDIALAGGQDHLKGKIFRIGHLGFVCERDVTSAIAALEVT 360 Query: 360 LIELGYEGVTPGSGVAAAAGVLAK 383 L +LGYE TPG +AAA+ VL + Sbjct: 361 LRDLGYESFTPGEALAAASRVLVE 384 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 385 Length adjustment: 30 Effective length of query: 354 Effective length of database: 355 Effective search space: 125670 Effective search space used: 125670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory