Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (characterized)
to candidate WP_011613168.1 TERY_RS18205 anthranilate synthase component I
Query= SwissProt::P20579 (493 letters) >NCBI__GCF_000014265.1:WP_011613168.1 Length = 511 Score = 400 bits (1029), Expect = e-116 Identities = 232/501 (46%), Positives = 321/501 (64%), Gaps = 24/501 (4%) Query: 5 EFLRLAAVGYNRIPLACETLADFDTPLSIYLKLA-DQPNSYLLESVQGGEKWGRYSMIGL 63 EF RLA G N +P+ E +AD DTP+S + ++ DQP S+LLESV+GGEK GRYS +G Sbjct: 8 EFSRLAKQG-NFVPVYQEWIADLDTPVSSWYRVCKDQPYSFLLESVEGGEKIGRYSFLGC 66 Query: 64 PSRTVMRVHGYHVSILHDGVEVESHDVEDPLAFVESFKDRYKVADIPGLPRFNGGLVGYF 123 ++ G H + + +V++ + +P + + YK +P LP GGL G++ Sbjct: 67 DPLWILEARGDHTTQTYRDGKVKTFE-GNPFDVLNNCLQDYKPVKLPQLPSGIGGLFGFW 125 Query: 124 GYDCVRYVEKRLGVSPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLVDPAE-----E 178 GY+ +R++E R+GV P + +PD L M D ++VFD + K+ AI D E Sbjct: 126 GYELIRWIEPRVGVYPATEN-DLPDGLWMQVDNLLVFDQVKRKILAIAYADIRSPEANLE 184 Query: 179 QAFEQGQARLQGLLETLRQPITPRRGL-DLSGPQAAEPEFRSSYT----REDYENAVGRI 233 A++Q R+ L++ LR P++ + L + P+ + EF +T R + V + Sbjct: 185 LAYQQTCDRVSELVDKLRSPLSRQNTLLEWQPPEGKDKEFTDIHTSNTPRAKFCANVEKA 244 Query: 234 KEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVL 293 KEYI AGD QVV SQ++S ++ P LYR+LR NP+PYM +FNFG++ V+GSSPEV+ Sbjct: 245 KEYIKAGDIFQVVISQQLSTEYTGEPFALYRSLRLINPSPYMAYFNFGNWQVIGSSPEVM 304 Query: 294 VRVEDN-----LVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLIDLGRNDVG 348 V+ E L TVRPIAGTR RG T D AL ++LL D KE AEH+ML+DLGRND+G Sbjct: 305 VKAEKTPDGKRLATVRPIAGTRRRGKTYAEDNALAEELLQDPKERAEHIMLVDLGRNDLG 364 Query: 349 RVSSTGSVRLTEKMVIERYSNVMHIVSNVAGQLREGLTAMDALRAILPAGTLSGAPKIRA 408 RV G+V++ + MVIERYS+VMHIVSNV G+L + TA D L+A PAGT+SGAPKIRA Sbjct: 365 RVCQVGTVKVDQLMVIERYSHVMHIVSNVVGELADDRTAWDLLKACFPAGTVSGAPKIRA 424 Query: 409 MEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVI---NDG--ELHVQAGGGIVAD 463 MEII+ELEP +RGVY G GY+ + G +++AI IRT V+ N+G + VQAG G+VAD Sbjct: 425 MEIINELEPCRRGVYSGVYGYYDFEGQLNSAITIRTMVVRPKNNGTHTVTVQAGAGLVAD 484 Query: 464 SVPALEWEETINKRRAMFRAV 484 SV E+EETINK R + A+ Sbjct: 485 SVAETEYEETINKARGLLEAI 505 Lambda K H 0.320 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 641 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 493 Length of database: 511 Length adjustment: 34 Effective length of query: 459 Effective length of database: 477 Effective search space: 218943 Effective search space used: 218943 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate WP_011613168.1 TERY_RS18205 (anthranilate synthase component I)
to HMM TIGR00564 (trpE: anthranilate synthase component I (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00564.hmm # target sequence database: /tmp/gapView.19858.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00564 [M=455] Accession: TIGR00564 Description: trpE_most: anthranilate synthase component I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-162 525.2 0.0 9.3e-162 525.0 0.0 1.0 1 lcl|NCBI__GCF_000014265.1:WP_011613168.1 TERY_RS18205 anthranilate syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000014265.1:WP_011613168.1 TERY_RS18205 anthranilate synthase component I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 525.0 0.0 9.3e-162 9.3e-162 2 454 .. 28 505 .. 27 506 .. 0.93 Alignments for each domain: == domain 1 score: 525.0 bits; conditional E-value: 9.3e-162 TIGR00564 2 dtltpisvylklak.rkesfllEsvekeeelgRySliglnpvleikakdgkavlleaddeeakieedel 69 d tp+s ++ k +++sfllEsve +e++gRyS++g++p ++a+++++++ d++ ++ e+++ lcl|NCBI__GCF_000014265.1:WP_011613168.1 28 DLDTPVSSWYRVCKdQPYSFLLESVEGGEKIGRYSFLGCDPLWILEARGDHTTQTYRDGKVKTFEGNPF 96 6789999999998879**********************************9999999999999****** PP TIGR00564 70 kelrklleka.eesedeldeplsggavGylgydtvrlveklkeea.edelelpdlllllvetvivfDhv 136 ++l+++l+ + + ++l+ gg++G+ gy+++r +e+ e +lpd l + v++++vfD+v lcl|NCBI__GCF_000014265.1:WP_011613168.1 97 DVLNNCLQDYkPVKLPQLPS-GIGGLFGFWGYELIRWIEPRVGVYpATENDLPDGLWMQVDNLLVFDQV 164 *********97788888887.579***************99986659999******************* PP TIGR00564 137 ekkvilienarteaers....aeeeaaarleellaelqkelekavkaleekkes.........ftsnve 192 ++k++ i++a ++ + a++++ +r++el+ +l+++l+++++ le ++ + tsn+ lcl|NCBI__GCF_000014265.1:WP_011613168.1 165 KRKILAIAYADIRSPEAnlelAYQQTCDRVSELVDKLRSPLSRQNTLLEWQPPEgkdkeftdiHTSNTP 233 ********99888776678899999***************99985554444433444677777778888 PP TIGR00564 193 keeyeekvakakeyikaGdifqvvlSqrleakveakpfelYrkLRtvNPSpylyyldledfelvgsSPE 261 ++++ ++v+kakeyikaGdifqvv+Sq+l+++ + +pf+lYr+LR +NPSpy++y+++ + +++gsSPE lcl|NCBI__GCF_000014265.1:WP_011613168.1 234 RAKFCANVEKAKEYIKAGDIFQVVISQQLSTEYTGEPFALYRSLRLINPSPYMAYFNFGNWQVIGSSPE 302 8******************************************************************** PP TIGR00564 262 llvkvk....gkr.vetrPiAGtrkRGatkeeDealeeeLladeKerAEHlmLvDLaRNDigkvaklgs 325 ++vk + gkr ++rPiAGtr+RG+t +eD+al+eeLl+d+KerAEH+mLvDL+RND+g+v+++g+ lcl|NCBI__GCF_000014265.1:WP_011613168.1 303 VMVKAEktpdGKRlATVRPIAGTRRRGKTYAEDNALAEELLQDPKERAEHIMLVDLGRNDLGRVCQVGT 371 ****998898788899***************************************************** PP TIGR00564 326 vevkellkiekyshvmHivSeVeGelkdeltavDalraalPaGTlsGAPKvrAmelidelEkekRgiYg 394 v+v++l+ ie+yshvmHivS+V+Gel+d+ ta+D l+a++PaGT+sGAPK+rAme+i+elE+ +Rg+Y+ lcl|NCBI__GCF_000014265.1:WP_011613168.1 372 VKVDQLMVIERYSHVMHIVSNVVGELADDRTAWDLLKACFPAGTVSGAPKIRAMEIINELEPCRRGVYS 440 ********************************************************************* PP TIGR00564 395 GavgylsfdgdvdtaiaiRtmvl.....kdgvayvqAgaGiVaDSdpeaEyeEtlnKakallrai 454 G+ gy++f+g++++ai+iRtmv+ +++ vqAgaG+VaDS+ e+EyeEt+nKa++ll+ai lcl|NCBI__GCF_000014265.1:WP_011613168.1 441 GVYGYYDFEGQLNSAITIRTMVVrpknnGTHTVTVQAGAGLVADSVAETEYEETINKARGLLEAI 505 ***********************44322235789***************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (511 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 7.64 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory