Align Histidinol-phosphate aminotransferase 2; EC 2.6.1.9; Imidazole acetol-phosphate transaminase 2 (uncharacterized)
to candidate WP_011613971.1 TERY_RS22660 histidinol-phosphate aminotransferase
Query= curated2:Q3MAX6 (380 letters) >NCBI__GCF_000014265.1:WP_011613971.1 Length = 376 Score = 438 bits (1126), Expect = e-127 Identities = 233/379 (61%), Positives = 278/379 (73%), Gaps = 11/379 (2%) Query: 1 MLPFIRSDLAQFTAYKPHPSSDTDAAVPAQLDRLDTNESPCDLPPELKQKLAWTFQQVIE 60 M FIRS+L AY PH + ++ LDRLDTNE P DLP LKQKLA +QQ+IE Sbjct: 1 MFTFIRSNLNNLKAYTPHSAGSSEIL----LDRLDTNECPYDLPDNLKQKLAENYQQLIE 56 Query: 61 SNRYPDGGHEELKDAIAQYVNESANISSSPITAANISVGNGSDELIRSLLIATCLGAQGS 120 +NRYPDG H +LK+AIA+YVNE S+ I+A NISVGNGSDELIRSLLI TC+G +GS Sbjct: 57 TNRYPDGSHLKLKEAIAKYVNEVT--PSANISANNISVGNGSDELIRSLLIVTCVGGEGS 114 Query: 121 ILVANPTFSMYGILAQTLGIPVVTVSRNPENFEIDLTAAQSAIEQTQNPPIRVVFVVHPN 180 IL A PTFSMY ILAQTLGIPVV V R NFEID+TAA+ AI T+NP I+ +FVVHPN Sbjct: 115 ILTATPTFSMYSILAQTLGIPVVNVGRKESNFEIDITAAEDAINHTKNPSIKAIFVVHPN 174 Query: 181 SPTANPLTTNELRWLKSLSEQILVVVDEAYFEFSQTTLISELVQRPNWVILRTFSKAFRL 240 SPTAN L + EL WL+SL + ILVV+DEAYFEFSQT+L EL Q PNWVILRTFSKAFRL Sbjct: 175 SPTANALNSQELVWLRSLPDDILVVIDEAYFEFSQTSLAEELNQHPNWVILRTFSKAFRL 234 Query: 241 AAMRVGYCVAHPEAIAILEKVRLPYNLPSFSITSALVALQNRAILLESIPQILNERAKLI 300 A++RVGY +AHPE I LEKVRLPYNLPSFS +A + L + LL IP+IL ER+KL Sbjct: 235 ASLRVGYAIAHPEIIINLEKVRLPYNLPSFSQAAAQLVLNHSQHLLSFIPEILRERSKLF 294 Query: 301 TALSKYPELAVAESAANFIFLQ-----LKTDNKNSPDTALLNLHQQLKNSGTLVRQISGG 355 + P L V +SAANF++++ LK K+S D +L +L Q+LK GTL+R GG Sbjct: 295 ATFGEIPALKVWKSAANFLYMRLTDEGLKLMGKSSQDQSLSSLMQRLKTQGTLIRHTGGG 354 Query: 356 LRITIGTPEENIRTLNHIQ 374 LRITIGT EEN RT+ I+ Sbjct: 355 LRITIGTSEENQRTVERIK 373 Lambda K H 0.317 0.131 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 453 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 376 Length adjustment: 30 Effective length of query: 350 Effective length of database: 346 Effective search space: 121100 Effective search space used: 121100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011613971.1 TERY_RS22660 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.17423.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-88 283.3 0.0 1.4e-88 283.0 0.0 1.0 1 lcl|NCBI__GCF_000014265.1:WP_011613971.1 TERY_RS22660 histidinol-phosphat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000014265.1:WP_011613971.1 TERY_RS22660 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 283.0 0.0 1.4e-88 1.4e-88 1 347 [. 6 373 .. 6 375 .. 0.92 Alignments for each domain: == domain 1 score: 283.0 bits; conditional E-value: 1.4e-88 TIGR01141 1 rekikklepYqpgarelgekevv..kLnsnEnPfgpsekvkealkeelk...klhrYpdpqalelkeal 64 r ++++l++Y+p ++ g +e++ +L++nE P++ ++++k++l e+ + + +rYpd ++l+lkea+ lcl|NCBI__GCF_000014265.1:WP_011613971.1 6 RSNLNNLKAYTP--HSAGSSEILldRLDTNECPYDLPDNLKQKLAENYQqliETNRYPDGSHLKLKEAI 72 678999999999..456665544448*******************998878899*************** PP TIGR01141 65 akylg.......veeenillgnGsdelielliraflepg.davlvleptysmYevsakiagaevkevpl 125 aky++ ++++ni +gnGsdeli+ l+ ++ g ++l++ pt+smY++ a++ g+ v++v lcl|NCBI__GCF_000014265.1:WP_011613971.1 73 AKYVNevtpsanISANNISVGNGSDELIRSLLIVTCVGGeGSILTATPTFSMYSILAQTLGIPVVNVGR 141 *****************************999999999979**************************** PP TIGR01141 126 ked.....gqedleavleaakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFsee 189 ke+ + +a++++++ ++k +f+ +Pn Pt n l+++e++ + d lVV+DeAY eFs++ lcl|NCBI__GCF_000014265.1:WP_011613971.1 142 KESnfeidITAAEDAINHTKNPSIKAIFVVHPNSPTANALNSQELVWLRSLPDDILVVIDEAYFEFSQT 210 999754433344555556888899**********************9999989***************6 PP TIGR01141 190 asvlellaeypnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdk 258 s +e l+++pn v+lrT+SKaf LA+lRvGyaia++eii lekvr pyn++s +++aa l++s++ lcl|NCBI__GCF_000014265.1:WP_011613971.1 211 -SLAEELNQHPNWVILRTFSKAFRLASLRVGYAIAHPEIIINLEKVRLPYNLPSFSQAAAQLVLNHSQH 278 .******************************************************************** PP TIGR01141 259 iektveevkkererlleelkkleglevyeSkaNFvlikvke.............daeelleallekgii 314 + + + e+ +er l++ + +++ l+v +S aNF+ +++ + l+++l+ +g + lcl|NCBI__GCF_000014265.1:WP_011613971.1 279 LLSFIPEILRERSKLFATFGEIPALKVWKSAANFLYMRLTDeglklmgkssqdqSLSSLMQRLKTQGTL 347 **************************************9988999999998766667899********* PP TIGR01141 315 vRdlksaeglleeclRitvGtreenerllealk 347 +R+ + g lRit+Gt+een+r +e +k lcl|NCBI__GCF_000014265.1:WP_011613971.1 348 IRHTG---G----GLRITIGTSEENQRTVERIK 373 **998...3....48*************99887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (376 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.53 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory