Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; EC 3.5.1.18; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase (uncharacterized)
to candidate WP_011649391.1 RL_RS36080 acetylornithine deacetylase
Query= curated2:Q5FPX5 (381 letters) >NCBI__GCF_000009265.1:WP_011649391.1 Length = 373 Score = 103 bits (256), Expect = 1e-26 Identities = 80/214 (37%), Positives = 105/214 (49%), Gaps = 16/214 (7%) Query: 59 NLYARLG-KGHPALCFAGHTDVVPPGEG-WAHDPFAAVIEGDRLYGRGIADMKGGVACFV 116 NL+A +G KG P +GH DVVP EG W DPF E DRLYGRG DMKG +A + Sbjct: 51 NLFATIGPKGEPGYILSGHMDVVPAAEGGWTSDPFRLRAEADRLYGRGATDMKGFLAAVL 110 Query: 117 AAVARRLEQGPLKGSVSLLITGDEEGPAHFGTKPVIEWLAERGELPDFCVLGEPTNPQAL 176 AAV L + PL+ V L + DEE G +I L E P ++GEP+ +A+ Sbjct: 111 AAVP-VLAETPLRRPVHLAFSYDEEAGCR-GVPHMIARLPELCATPLGAIIGEPSGMRAI 168 Query: 177 GDVIKIGRRGSMNAVVTVHGTQGHVAYPHLADNPVHRL--LAAFSELTARELDAG--SEW 232 +G A +TV G GH + P N +H + + A + A L G Sbjct: 169 R-----AHKGKAAARLTVKGRSGHSSRPDQGLNAIHAITDVLACARAEAERLTRGPFEHV 223 Query: 233 FDP--SSLQVTSIDVGNGATNIIPGSAVGRLNIR 264 F+P SSLQV ++ G A NIIP + R Sbjct: 224 FEPPYSSLQVGTLK-GGQAVNIIPDTCEAEFEAR 256 Lambda K H 0.319 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 373 Length adjustment: 30 Effective length of query: 351 Effective length of database: 343 Effective search space: 120393 Effective search space used: 120393 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory