Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate WP_011650226.1 RL_RS02270 succinyl-diaminopimelate desuccinylase
Query= BRENDA::Q9KQ52 (377 letters) >NCBI__GCF_000009265.1:WP_011650226.1 Length = 397 Score = 284 bits (727), Expect = 3e-81 Identities = 162/386 (41%), Positives = 218/386 (56%), Gaps = 18/386 (4%) Query: 1 MTDSPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFE-----DTTNFWAR 55 MT + +A + LI SVTPA+ G + L LGF ++ + D N +AR Sbjct: 1 MTATDPVANLQTLIRCPSVTPAEGGALSALEAMLAPLGFTVDRVKASEEGTPDIENLYAR 60 Query: 56 RGTQSPLFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVER 115 GT P +FAGHTDVVP G + W PPF + G L GRGA DMKG +AC + AV R Sbjct: 61 LGTDGPHLMFAGHTDVVPVGDEAAWTHPPFAAEISKGELFGRGAVDMKGGIACFVAAVAR 120 Query: 116 FIAEHPDHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVV 175 I + +GSI FLIT DEEGP INGT+++++ R E D C+VGEP++ +GD++ Sbjct: 121 HIEKSGQPKGSISFLITGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMI 180 Query: 176 KNGRRGSITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQI 235 K GRRGS++G + V G QGH AYPHLA+NPV L L +D G F P++ ++ Sbjct: 181 KIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQMTHALMDPPFDGGTDDFQPSNLEV 240 Query: 236 PNLQAGTGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHG-----------LDY 284 + G A+NVIP + FN RF+ T E ++ + LDA + Y Sbjct: 241 TTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLDAAAGNGELRPGRDPVKY 300 Query: 285 DVKWT-LSGQPFLTDTGELLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELG 343 D+ W FLT L+A++ +AVE V+ Q+P L TTGGTSD RFI VVE G Sbjct: 301 DIVWADRPSHVFLTRNNALIASLSSAVESVSGQSPKLSTTGGTSDARFIKDY-CPVVEFG 359 Query: 344 PVNATIHKVNECVRIADLEKLTDMYQ 369 V T+H V+E V +ADLE LT +Y+ Sbjct: 360 LVGQTMHMVDERVAVADLETLTAIYE 385 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 397 Length adjustment: 30 Effective length of query: 347 Effective length of database: 367 Effective search space: 127349 Effective search space used: 127349 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011650226.1 RL_RS02270 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.7895.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-128 414.0 0.0 3.3e-128 413.7 0.0 1.0 1 lcl|NCBI__GCF_000009265.1:WP_011650226.1 RL_RS02270 succinyl-diaminopimel Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009265.1:WP_011650226.1 RL_RS02270 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.7 0.0 3.3e-128 3.3e-128 5 369 .. 10 390 .. 7 391 .. 0.97 Alignments for each domain: == domain 1 score: 413.7 bits; conditional E-value: 3.3e-128 TIGR01246 5 akeLisrksvtPndagaqeliaerLkklgfeieilefe.....dtknlwatrgteepvlvfaGhtDvvP 68 ++ Li+ +svtP++ ga++ +++ L lgf++++++ d++nl+a+ gt+ p+l+faGhtDvvP lcl|NCBI__GCF_000009265.1:WP_011650226.1 10 LQTLIRCPSVTPAEGGALSALEAMLAPLGFTVDRVKASeegtpDIENLYARLGTDGPHLMFAGHTDVVP 78 688****************************99987642334489************************ PP TIGR01246 69 aGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidG 137 +G++ +W+ +pf++e+ +G l+grGa+Dmkg++a+fv+a+ r+++k + kGs+s+lit Deeg ai+G lcl|NCBI__GCF_000009265.1:WP_011650226.1 79 VGDEAAWTHPPFAAEISKGELFGRGAVDMKGGIACFVAAVARHIEKSGQPKGSISFLITGDEEGPAING 147 ********************************************************************* PP TIGR01246 138 tkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavp 206 t+k++++ er e d ++vgeP+ ++lGD+ikiGrrGs++gk++++G+qGh aYPh+a+nPv +++ lcl|NCBI__GCF_000009265.1:WP_011650226.1 148 TIKLLQWAAERGERWDACLVGEPTNPDRLGDMIKIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQ 216 ********************************************************************* PP TIGR01246 207 vlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkh 275 + ++l++ +D G++ f+ps+l+++ +++g+ a+nviP++++++fn+rf+ ++++e+l+ ++ + ld+ lcl|NCBI__GCF_000009265.1:WP_011650226.1 217 MTHALMDPPFDGGTDDFQPSNLEVTTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLDAA 285 ******************************************************************998 PP TIGR01246 276 ...........kldYelewk.lsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklga 332 ++Y++ w + ++ flt+++ li+++ +a+e v++++p+lst+GGtsDarfi+++ + lcl|NCBI__GCF_000009265.1:WP_011650226.1 286 agngelrpgrdPVKYDIVWAdRPSHVFLTRNNALIASLSSAVESVSGQSPKLSTTGGTSDARFIKDY-C 353 899999999988*******736799******************************************.* PP TIGR01246 333 evvelGlvndtihkvneavkiedleklsevyekllee 369 vve+Glv +t+h v+e+v ++dle l+++ye+++++ lcl|NCBI__GCF_000009265.1:WP_011650226.1 354 PVVEFGLVGQTMHMVDERVAVADLETLTAIYETFIAR 390 *********************************9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.01 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory