Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_011650234.1 RL_RS02315 acetylglutamate kinase
Query= BRENDA::A0A0H2X8L7 (447 letters) >NCBI__GCF_000009265.1:WP_011650234.1 Length = 295 Score = 107 bits (268), Expect = 4e-28 Identities = 85/277 (30%), Positives = 132/277 (47%), Gaps = 22/277 (7%) Query: 35 FSQLDAKRFAVVKVGGAVLRDDL--EALTSSLSFLQEVGLTPIVLHGAGPQLDAELSAAG 92 F Q + VVK GG + + +A S ++ L++ G+ PIV+HG GPQ+ A LS G Sbjct: 19 FMQRYENKTIVVKYGGHAMGNPELGKAFASDIALLKQSGVNPIVVHGGGPQIGAMLSKMG 78 Query: 93 IEKQTVNGLRVTSPHALAIVRKVFQAS-NLKLVEALQQNGARATSI---TGGVFEAEYLN 148 IE + GLRVT + IV V S N ++V + Q G A + G + AE Sbjct: 79 IESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAR 138 Query: 149 RDT------------YGLVGEVKAVNLAPIEASLQAGSIPVITSLGETPSGQILNVNADF 196 + G VGEV V+ ++ ++ IPVI + G N+NAD Sbjct: 139 KTVKDPDSNIERVLDLGFVGEVVEVDRTLLDLLARSEMIPVIAPVAPGRDGATYNINADT 198 Query: 197 AANELVQELQPYKIIFLTGTGGLLDAEGKLIDSINLSTEYDHLMQQPWINGGMRVKIEQI 256 A + L +++FLT G+LD G+LI ++++ E L+ I+GGM K+E Sbjct: 199 FAGAIAGALNATRLLFLTDVPGVLDKNGQLIKELSVA-EAHALIADGTISGGMIPKVETC 257 Query: 257 KDLLDRLPLESSVSITRPA--DLAKELFTHKGSGTLV 291 D + + ++ V + + E+FT G GTL+ Sbjct: 258 IDAI-KAGVQGVVILNGKTAHSVLLEIFTEHGVGTLI 293 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 295 Length adjustment: 29 Effective length of query: 418 Effective length of database: 266 Effective search space: 111188 Effective search space used: 111188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory