Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate WP_011651805.1 RL_RS11450 serine O-acetyltransferase
Query= BRENDA::C4IRW0 (281 letters) >NCBI__GCF_000009265.1:WP_011651805.1 Length = 277 Score = 387 bits (994), Expect = e-112 Identities = 185/262 (70%), Positives = 219/262 (83%) Query: 20 LDQVDPIWHSIRAEAEEATRNDPVLGAFLYATILNQPSLEEAVMHRIAERLGHPDVSADI 79 L +DPIW S+R EA A DPVL AFLY+T++N SLEE V+HRI ERL HPD+ A++ Sbjct: 16 LKVMDPIWDSLREEARLAAERDPVLAAFLYSTVINYHSLEECVIHRICERLDHPDMQANL 75 Query: 80 LRQTFDTMLEANPEWSHVLRVDIQAVYDRDPAYSRFMDPVLYLKGFHAIQTHRLAHWLYK 139 LRQTF+ ML P+WS +LRVDIQA+YDRDPA RFM+ VLY KGFHA+QTHRLAHWL Sbjct: 76 LRQTFEEMLLDWPDWSSILRVDIQAIYDRDPACLRFMEAVLYFKGFHALQTHRLAHWLLN 135 Query: 140 QGRKDFAYYLQSRSSSIFQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHGVTL 199 +GR+DFA YLQSRSSS+FQTDI+PAAR+G G+FLDHATGLVVGETAV+ DNVSILHGVTL Sbjct: 136 RGRRDFALYLQSRSSSVFQTDINPAARIGKGIFLDHATGLVVGETAVIGDNVSILHGVTL 195 Query: 200 GGTGKSSGDRHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPAR 259 GGTGK DRHPKI GV+IGAGAKILGNI++G CS++AAGSVVLK+VP TVAGVPA+ Sbjct: 196 GGTGKEGADRHPKIGSGVMIGAGAKILGNIEIGYCSRVAAGSVVLKAVPPKKTVAGVPAK 255 Query: 260 IIGETGCTEPSRVMDQMLGDGI 281 ++GE GC+EPSR MDQ++G I Sbjct: 256 VVGEAGCSEPSRNMDQVIGADI 277 Lambda K H 0.320 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 277 Length adjustment: 26 Effective length of query: 255 Effective length of database: 251 Effective search space: 64005 Effective search space used: 64005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_011651805.1 RL_RS11450 (serine O-acetyltransferase)
to HMM TIGR01172 (cysE: serine O-acetyltransferase (EC 2.3.1.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01172.hmm # target sequence database: /tmp/gapView.17290.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01172 [M=162] Accession: TIGR01172 Description: cysE: serine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-71 225.9 1.0 4.4e-70 221.0 0.3 2.0 2 lcl|NCBI__GCF_000009265.1:WP_011651805.1 RL_RS11450 serine O-acetyltransf Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009265.1:WP_011651805.1 RL_RS11450 serine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.8 0.0 0.0029 0.0029 3 41 .. 28 67 .. 26 84 .. 0.78 2 ! 221.0 0.3 4.4e-70 4.4e-70 2 162 .] 95 255 .. 94 255 .. 0.99 Alignments for each domain: == domain 1 score: 3.8 bits; conditional E-value: 0.0029 TIGR01172 3 edlkavlerDPaaesal.evlllykglhallayrlahaly 41 e+ + + erDP l + +++y++l +++r+ ++l lcl|NCBI__GCF_000009265.1:WP_011651805.1 28 EEARLAAERDPVLAAFLySTVINYHSLEECVIHRICERLD 67 66677899***987754278899************99875 PP == domain 2 score: 221.0 bits; conditional E-value: 4.4e-70 TIGR01172 2 kedlkavlerDPaaesalevlllykglhallayrlahalykrklkllarllselvrvltgvdihPaaki 70 + d++a+++rDPa+ + +e +l++kg+hal+++rlah+l +r+++ +a +l+++++ +++ di Paa+i lcl|NCBI__GCF_000009265.1:WP_011651805.1 95 RVDIQAIYDRDPACLRFMEAVLYFKGFHALQTHRLAHWLLNRGRRDFALYLQSRSSSVFQTDINPAARI 163 679****************************************************************** PP TIGR01172 71 grgvliDhatGvviGetavigddvsiyqgvtLGgtgkekgkRhPtvkegvvigagakvLGnievgenak 139 g+g+++DhatG+v+Getavigd+vsi++gvtLGgtgke ++RhP+++ gv+igagak+LGnie+g ++ lcl|NCBI__GCF_000009265.1:WP_011651805.1 164 GKGIFLDHATGLVVGETAVIGDNVSILHGVTLGGTGKEGADRHPKIGSGVMIGAGAKILGNIEIGYCSR 232 ********************************************************************* PP TIGR01172 140 iGansvvlkdvpaeatvvGvpar 162 + a+svvlk vp++ tv+Gvpa+ lcl|NCBI__GCF_000009265.1:WP_011651805.1 233 VAAGSVVLKAVPPKKTVAGVPAK 255 *********************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (162 nodes) Target sequences: 1 (277 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.64 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory