Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_011652894.1 RLEG_RS14640 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_000023185.1:WP_011652894.1 Length = 401 Score = 371 bits (952), Expect = e-107 Identities = 198/382 (51%), Positives = 249/382 (65%), Gaps = 12/382 (3%) Query: 4 SALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNV 63 +ALLVL DGT G+ IGATG EVVFNT++TGY+EILTDPSY QIVT T+PHIGN+ Sbjct: 13 TALLVLADGTVIEGKGIGATGKVPAEVVFNTALTGYEEILTDPSYLGQIVTFTFPHIGNI 72 Query: 64 GTNDADEE----SSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLT 119 GTND D E +++ A G++ + SN+R + L +LK ++ + IDTR LT Sbjct: 73 GTNDEDIEDLTPAARHGAVGVIFKADITEPSNYRAAKHLDQWLKARGVIGLCGIDTRALT 132 Query: 120 RLLREKGAQNGCIIAGDNPDAALALE----KARAFPGLNGMDLAKEVTTAEAYSWTQGSW 175 +RE GA N +IA D P+ +E +A+A+ GL G+DLAK ++ ++ WT+ W Sbjct: 133 AWIRENGAPNA-VIAHD-PNGVFDIETLKAEAKAWSGLEGLDLAKIASSGQSSQWTETPW 190 Query: 176 TLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDG 235 G E K D +HVV D+G KRNILR+ C++T+VPA TSAEDVL M PDG Sbjct: 191 VWNEGYGELKATDA-KYHVVCLDYGVKRNILRLFAGLDCKVTVVPAATSAEDVLAMQPDG 249 Query: 236 IFLSNGPGDPAPC-DYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGN 294 IFLSNGPGDPA DYA+ I+ ++TDIPVFGICLGHQ+L LA GAKT KM GHHG N Sbjct: 250 IFLSNGPGDPAATGDYAVPVIKTLIKTDIPVFGICLGHQMLGLALGAKTEKMHQGHHGAN 309 Query: 295 HPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHP 354 HPVKD V I + NHGFAVD +LP + TH SLFDGT G+ K FS Q HP Sbjct: 310 HPVKDHTTGKVEIVSMNHGFAVDSKSLPDGVEETHISLFDGTNCGLRVLGKQVFSVQHHP 369 Query: 355 EASPGPHDAAPLFDHFIELIEQ 376 EASPGP D+ LF FI ++ + Sbjct: 370 EASPGPQDSHYLFRRFINMVRE 391 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 471 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 401 Length adjustment: 31 Effective length of query: 351 Effective length of database: 370 Effective search space: 129870 Effective search space used: 129870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011652894.1 RLEG_RS14640 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.12110.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-130 421.4 0.0 1.6e-130 421.2 0.0 1.0 1 lcl|NCBI__GCF_000023185.1:WP_011652894.1 RLEG_RS14640 carbamoyl-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000023185.1:WP_011652894.1 RLEG_RS14640 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 421.2 0.0 1.6e-130 1.6e-130 1 360 [. 14 390 .. 14 391 .. 0.94 Alignments for each domain: == domain 1 score: 421.2 bits; conditional E-value: 1.6e-130 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk 69 a lvl+dGtv+egk++ga+++v +evvFnT++tGY+EiltDpsY gqiv++t p+ign+g+n+ed+e lcl|NCBI__GCF_000023185.1:WP_011652894.1 14 ALLVLADGTVIEGKGIGATGKVPAEVVFNTALTGYEEILTDPSYLGQIVTFTFPHIGNIGTNDEDIEDL 82 579***************************************************************866 PP TIGR01368 70 ....kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse 134 + + g++ k +e+snyra + L+++lk +g++++ g+DTRal+ +Re+g+ +avi+++ + lcl|NCBI__GCF_000023185.1:WP_011652894.1 83 tpaaRHGAVGVIFKADITEPSNYRAAKHLDQWLKARGVIGLCGIDTRALTAWIRENGAPNAVIAHDPNG 151 222255678*******************************************************99976 PP TIGR01368 135 ...keelvekakespkvkevnlvkevstkeayeleq..........kakkegkklrvvvidlGvKenil 190 e+l+++ak+ +++++l+k +s + +++++ + k+++ k++vv +d+GvK+nil lcl|NCBI__GCF_000023185.1:WP_011652894.1 152 vfdIETLKAEAKAWSGLEGLDLAKIASSGQSSQWTEtpwvwnegygELKATDAKYHVVCLDYGVKRNIL 220 666788999999999*******************997777765554488889999************** PP TIGR01368 191 reLvkrgvevtvvpadtsaeeikklnpdgillsnGPGdPaav.eeaietvkklleakiPifGIclGhql 258 r ++ +++vtvvpa tsae++ +++pdgi+lsnGPGdPaa ++a+ +k+l++++iP+fGIclGhq+ lcl|NCBI__GCF_000023185.1:WP_011652894.1 221 RLFAGLDCKVTVVPAATSAEDVLAMQPDGIFLSNGPGDPAATgDYAVPVIKTLIKTDIPVFGICLGHQM 289 ***************************************87626789999******************* PP TIGR01368 259 lalalgaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtvegleh 327 l+lalgakt k++ Gh+GaNhpvkd++tg+vei s NHg+avd++sl+ + +e th +l+Dgt+ gl+ lcl|NCBI__GCF_000023185.1:WP_011652894.1 290 LGLALGAKTEKMHQGHHGANHPVKDHTTGKVEIVSMNHGFAVDSKSLPDG-VEETHISLFDGTNCGLRV 357 **********************************************8855.****************** PP TIGR01368 328 kelpvfsvQyHPeaspGphdteylFdefvelik 360 ++vfsvQ+HPeaspGp+d++ylF++f+++++ lcl|NCBI__GCF_000023185.1:WP_011652894.1 358 LGKQVFSVQHHPEASPGPQDSHYLFRRFINMVR 390 ******************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.02 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory