Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate WP_011652923.1 RL_RS17735 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::P9WPZ5 (397 letters) >NCBI__GCF_000009265.1:WP_011652923.1 Length = 400 Score = 162 bits (410), Expect = 2e-44 Identities = 121/400 (30%), Positives = 196/400 (49%), Gaps = 29/400 (7%) Query: 3 VSRLRPYATTVFAEMSALATRIG--AVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPG 60 +SR++P AT ++ + G + LG G PD D P + AA DAI G +Y P Sbjct: 8 LSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKTAAIDAINRGETKYTPV 67 Query: 61 PGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYD 120 G LR+AIAA+ +R G+DY E + +V G + + A + + PG EV++ P++ Sbjct: 68 SGIPELRKAIAAKFKRENGLDYSWE-QTIVGTGGKQILFNAFMATLNPGDEVVIPAPYWV 126 Query: 121 SYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATE 180 SY +VA+ G V V + F L A L +A+TP+T+ I NSP NPTGA + E Sbjct: 127 SYPEMVALCGGTPVFVSATQE-HNFKLQAADLEKAITPKTKWFIFNSPSNPTGAAYTQDE 185 Query: 181 LAAIAEIAVAANLV-VITDEVYEHLVFDHARHL-PLAGFDGMAERTITISSAAKMFNCTG 238 L A+ ++ + V V+TD++YEHL + + + P+ + +RT+T++ +K + TG Sbjct: 186 LKALTDVLMKHPQVWVLTDDMYEHLTYGDFKFVTPVEVEPKLYDRTLTMNGVSKAYAMTG 245 Query: 239 WKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRL 298 W+IG+A GP +LI + + + + Q A AL+ ++ A + RRD + Sbjct: 246 WRIGYAAGPIQLIKAMDMIQGQQTSGATSIAQWAAVEALNGTQGFIPANKKIFEGRRDLV 305 Query: 299 AAGLTEIGFAV----HDSYGTYFLCAD------PRPLGYDDSTEFCAALPEKVGVAAIPM 348 + L + V ++ Y CA P + +F + L E GVA + Sbjct: 306 VSMLNQAKGIVCPVPEGAFYVYPSCAGLIGKTAPSGKVIETDEDFVSELLETEGVAVVHG 365 Query: 349 SAFCDPAAGQASQQADVWNHLVRFTFCKRDDTLDEAIRRL 388 SAF G R ++ ++ L+EA RR+ Sbjct: 366 SAF-----GLGPN--------FRISYATSEELLEEACRRI 392 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 400 Length adjustment: 31 Effective length of query: 366 Effective length of database: 369 Effective search space: 135054 Effective search space used: 135054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory