Align Methionine synthase component, pterin-binding domain (EC:2.1.1.13) (characterized)
to candidate WP_011735322.1 PPRO_RS07025 5-methyltetrahydrofolate--homocysteine methyltransferase
Query= reanno::Phaeo:GFF1582 (353 letters) >NCBI__GCF_000015045.1:WP_011735322.1 Length = 806 Score = 193 bits (490), Expect = 2e-53 Identities = 109/293 (37%), Positives = 166/293 (56%), Gaps = 21/293 (7%) Query: 4 TVVESKTKTAILGFDEPFCVIGERINPTGRKKLAAELEAGDFSTVEKDALAQVMAGANIL 63 T++ + +G + +IGERINPTG+K + EL+ G S + ++A+ Q GA +L Sbjct: 304 TLLSCRGGWTAVGPGQKTAIIGERINPTGKKLYSKELQEGKVSYIRREAMEQAQLGATLL 363 Query: 64 DINAGVVYNSNPNPNETEPPLMTKIVELVQGLTDTPLCIDSSVPGALEAGLQAAEGRPLL 123 D+N G P EP M + V G PL +DSS P ALEAGL+AA+G+ L+ Sbjct: 364 DLNVGA-------PGIDEPVAMERAVFCASGAVGVPLVLDSSSPAALEAGLKAADGKVLI 416 Query: 124 NSVTGEEERLEHVLPLVKKYNVPVVAISNDDTGISEDPDVRFAVAKKIVERAADFGIPAH 183 NSV+GE + L VLPL KKY ++ ++ D GI + + R A+A++I A GIP Sbjct: 417 NSVSGEAKSLSRVLPLAKKYGAALIGLTLDAKGIPDSAEGRLAIARRIRNAARRQGIPDQ 476 Query: 184 DIVVDPLVMPIGAMATAGQQVFALVRRLREELGVNTTCGASNVSFGLPNRHGINNAFLPM 243 DI++D L + + A + +R ++E+LG++T G SN+SFGLP R I+++F M Sbjct: 477 DIIIDCLTLTVSAEQKRAAETLRTIRLVKEKLGLSTVLGVSNISFGLPQRPLISSSFFSM 536 Query: 244 AMGAGMTSAIMNPVALPITQKKIAEKKAEVEA---AGIILPEGMEDEAFVQMF 293 AM AG+ +AI+NP +KA ++A A ++L EAF+Q + Sbjct: 537 AMAAGLDAAIINP-----------REKAMMDAWRSAMVLLNRDPRAEAFIQTY 578 Lambda K H 0.315 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 588 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 806 Length adjustment: 35 Effective length of query: 318 Effective length of database: 771 Effective search space: 245178 Effective search space used: 245178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory