Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate WP_011736058.1 PPRO_RS10870 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q82WA8 (397 letters) >NCBI__GCF_000015045.1:WP_011736058.1 Length = 397 Score = 382 bits (981), Expect = e-110 Identities = 197/392 (50%), Positives = 267/392 (68%), Gaps = 3/392 (0%) Query: 1 MKLSQRVQAIKPSPTLAVTAKAARLKAEGKNIIGLGAGEPDFDTPLHIKDAAITAIRNGF 60 MKL+ RV I+PSPTLA+ AKA LKA+G ++I GAGEPDFDTP I+DAA AI +GF Sbjct: 1 MKLADRVHRIQPSPTLAIDAKAKALKAQGVDVISFGAGEPDFDTPDAIRDAARNAIDSGF 60 Query: 61 TKYTAVGGTASLKQAIISKFKRENSLEFMPGEILVSSGGKQSFFNLVLATIDPGDEVIIP 120 T+Y VGG LK AII K KR++ +E+ EI VS G K S +N+ A I GDEVIIP Sbjct: 61 TRYMPVGGADDLKDAIILKMKRDHGIEYSRAEICVSCGAKHSLYNISQALIQEGDEVIIP 120 Query: 121 APYWVSYPDIVLIAEGKPVFIDTGIEEKFKISPDQLEKAITPRTRMFVVNSPSNPSGSVY 180 APYWVSYPD V++A G P+FI T + FKI+P QLE AITPRT+ ++NSP NP+G+ Y Sbjct: 121 APYWVSYPDQVVLAGGTPIFIQTDEKSDFKITPRQLEAAITPRTKAMILNSPCNPTGTSY 180 Query: 181 SLEELQALGAVLRKYPDILIATDDMYEHILLSGDGFVNILNACPDLKARTVVLNGVSKAY 240 + EEL+A+ V + D +I +DD+YE ++ G F NI+ P+LK R V++NGVSK Y Sbjct: 181 TGEELRAIAQVCLAH-DFIIISDDIYERLIYDGQVFSNIVQVAPELKQRVVLVNGVSKTY 239 Query: 241 AMTGWRIGYCGGPAAIITAMENIQSQSTSNPNSIAQVAAEAALNGDQSCMVPMIEAFRER 300 AMTGWRIGY GP +I AM +QSQSTSN SIAQ A+ A+ G Q + M++ F +R Sbjct: 240 AMTGWRIGYACGPQELIAAMTKMQSQSTSNACSIAQKASVEAIAGSQEKVTAMVQEFEKR 299 Query: 301 NQFLTNALNSIAGIHCLLSEGAFYAFVDVRQAISRLNTQQILQNSSDIAFCNYVLEKAEV 360 ++ LN++ G+ C S GAFYAF + + +I+ +S+D+A +Y+LE+A+V Sbjct: 300 RTYIVQRLNAMPGVTCFNSTGAFYAFPNFSALYGKSFNGKIIASSTDLA--DYLLEEAKV 357 Query: 361 AAVPGSAFGCEGYMRLSFATSMDNLQEAVKRI 392 A VPG AFG + Y RLS+A ++++ E + R+ Sbjct: 358 ALVPGVAFGDDRYARLSYAIGLESIAEGMDRL 389 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 397 Length adjustment: 31 Effective length of query: 366 Effective length of database: 366 Effective search space: 133956 Effective search space used: 133956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory