Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_011736388.1 PPRO_RS12495 aspartate carbamoyltransferase
Query= curated2:Q3A9W4 (311 letters) >NCBI__GCF_000015045.1:WP_011736388.1 Length = 310 Score = 127 bits (319), Expect = 3e-34 Identities = 96/313 (30%), Positives = 164/313 (52%), Gaps = 20/313 (6%) Query: 2 IASYRGRDFLSMNDLTGEEIEEVLDLASELKIRQKKGIS-TPILKGKTLAMIFSKNSTRT 60 +A+++ +D +++ DLT +EIE +L A ++ + I P L+GKT+ +F ++STRT Sbjct: 1 MANFKHKDIIALQDLTKQEIELLLSTAESMREINNRDIKKVPTLRGKTIVNLFYESSTRT 60 Query: 61 RVSFEVGMVQLGGYPLFITATDSQLSRGEPIADTARVLSRMVDGIMIRTYSHSEVEE-LA 119 R SFE+ +L + I+ + S ++GE +ADTA L M I++ +S S L+ Sbjct: 61 RTSFELAAKRLSADTVNISPSTSSATKGETLADTALNLLAMKPDIIVMRHSVSGSHYFLS 120 Query: 120 YYADVPVIN-GLTDYEHPCQIMADLLTIKEHKGQLRGLKVAWVGD--GNNVCHSLMIGAA 176 ++N G +EHP Q + D+LT+K+ G+L GLKVA VGD + V S + G Sbjct: 121 KKLPCSIVNAGDGVHEHPSQGLLDMLTMKDRFGRLDGLKVAIVGDISHSRVARSNIQGLT 180 Query: 177 KVGMEVAVATPPGYEPD--QKVSLIAQKETSRWGTKLLLTHDPVEAVTGADVVVTDVWAS 234 K+G +V +A PP P +++ + ++ R EA+ ADVV+ Sbjct: 181 KLGSQVFLAGPPTMMPPGVERLGNVTVCDSLR------------EAIQDADVVMMLRIQQ 228 Query: 235 MGQEAESAERVKVFEPY-QVNGELVSHAKQDFIFLHCLPAHRGEEVTAEVIDGEHSVVFA 293 Q + + Y +N E + AK D + +H P +RG E+ + V+DG+ S + Sbjct: 229 ERQGKTLMPNAREYARYFGLNPENLKLAKPDAMVMHPGPINRGVEMASSVVDGDQSWILK 288 Query: 294 EAENRLHAQKAIL 306 + EN + + ++L Sbjct: 289 QVENGVAVRMSML 301 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 310 Length adjustment: 27 Effective length of query: 284 Effective length of database: 283 Effective search space: 80372 Effective search space used: 80372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory