Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate WP_011736876.1 PPRO_RS15100 ATP phosphoribosyltransferase
Query= reanno::azobra:AZOBR_RS19500 (222 letters) >NCBI__GCF_000015045.1:WP_011736876.1 Length = 212 Score = 209 bits (531), Expect = 4e-59 Identities = 108/211 (51%), Positives = 142/211 (67%), Gaps = 3/211 (1%) Query: 7 LVLALPKGRILKELRPLLAHAGIEPEAAFDDADSRLLRFATNIPNLSIIRVRSFDVATFV 66 + +A+PKGRIL+E L GI+ DSR L F + + + VR+ DV T+V Sbjct: 5 ITIAIPKGRILEESVDLFGRIGIDCRELL--GDSRKLIFENPLQKMRYMIVRATDVPTYV 62 Query: 67 AFGAAHLGVAGNDVLMEFDYPEIYAPLDLGIGKCRLSVAEPVELGESDDPSRWSHVRVAT 126 +G+A LG+ G D LME D ++Y PLDL G CR+ VAEP L DDPS WSH+R+AT Sbjct: 63 EYGSADLGIVGKDTLMEQD-KDLYEPLDLKFGYCRMMVAEPANLATHDDPSAWSHIRIAT 121 Query: 127 KYPEVTRKHFAARGVQAECVKLNGAMELAPTLGLCRRIVDLVSTGSTLKANGLVEIEHIA 186 KYP V +FAA+G+Q E +KL G++ELAP +GL RIVDLVSTG TL+ NGLVE+E IA Sbjct: 122 KYPHVAGNYFAAKGIQVEIIKLYGSIELAPLVGLSERIVDLVSTGETLRQNGLVEVETIA 181 Query: 187 DVTSRLIVNRAAFKTRPEEISGWIDRFREAV 217 ++T+RLIVNRA+ KT+ E ISG I + + Sbjct: 182 EITTRLIVNRASLKTKHERISGIIRNLEQVI 212 Lambda K H 0.321 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 212 Length adjustment: 22 Effective length of query: 200 Effective length of database: 190 Effective search space: 38000 Effective search space used: 38000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_011736876.1 PPRO_RS15100 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.10953.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-67 211.7 0.0 4.6e-67 211.5 0.0 1.0 1 lcl|NCBI__GCF_000015045.1:WP_011736876.1 PPRO_RS15100 ATP phosphoribosylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015045.1:WP_011736876.1 PPRO_RS15100 ATP phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 211.5 0.0 4.6e-67 4.6e-67 1 183 [] 5 189 .. 5 189 .. 0.97 Alignments for each domain: == domain 1 score: 211.5 bits; conditional E-value: 4.6e-67 TIGR00070 1 lriAlpKGrleeetlkllekaglklskke..erkliasaedeevevlllrakdiptyvekgaadlGitG 67 ++iA+pKGr++ee+++l+ ++g+++++ +rkli++++ ++++++++ra+d+ptyve+g+adlGi+G lcl|NCBI__GCF_000015045.1:WP_011736876.1 5 ITIAIPKGRILEESVDLFGRIGIDCRELLgdSRKLIFENPLQKMRYMIVRATDVPTYVEYGSADLGIVG 73 79************************99888************************************** PP TIGR00070 68 kDlleEseadvvelldlgfgkcklvlAvpees.dvesledlkegkriATkypnltreylekkgvkveiv 135 kD+l+E+++d++e ldl+fg c++++A p + + +++++ + + riATkyp+++ +y++ kg++vei+ lcl|NCBI__GCF_000015045.1:WP_011736876.1 74 KDTLMEQDKDLYEPLDLKFGYCRMMVAEPANLaTHDDPSAWS-HIRIATKYPHVAGNYFAAKGIQVEII 141 *******************************95666666666.78************************ PP TIGR00070 136 kleGavElapllgladaIvDivetGttLrengLkiieeilessarlia 183 kl+G++Elapl+gl++ IvD+v+tG+tLr+ngL+++e+i e+++rli+ lcl|NCBI__GCF_000015045.1:WP_011736876.1 142 KLYGSIELAPLVGLSERIVDLVSTGETLRQNGLVEVETIAEITTRLIV 189 **********************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (212 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.13 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory