Align 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 (characterized)
to candidate WP_011737072.1 PPRO_RS16245 dihydrodipicolinate reductase
Query= SwissProt::Q9X1K8 (216 letters) >NCBI__GCF_000015045.1:WP_011737072.1 Length = 251 Score = 90.5 bits (223), Expect = 3e-23 Identities = 56/171 (32%), Positives = 93/171 (54%), Gaps = 2/171 (1%) Query: 43 DVVIDFSSPEALPKTVDLCKKYRAGLVLGTTALKEEHLQMLRELSKEVPVVQAYNFSIGI 102 DV+IDFSS + + + + + +V + E + L+ L++E VV + N +IGI Sbjct: 74 DVIIDFSSEQGVDYYGEEARGRKIAVVSAISEYSPEKREYLKYLAEETRVVWSPNITIGI 133 Query: 103 NVLKRFLSELVKVLEDWDVEIVETHHRFKKDAPSGTAILLESALG-KSVPIHSLRVGGVP 161 N L L + D+EIVE H + K + SGTA + ALG I ++R GG+ Sbjct: 134 NFLMIAAKVLKNIAPYTDIEIVEEHFKGKPEV-SGTARKIALALGLPEGAIKTIRAGGII 192 Query: 162 GDHVVVFGNIGETIEIKHRAISRTVFAIGALKAAEFLVGKDPGMYSFEEVI 212 G H ++FG +T+ +KH +I+R F G L AA ++ ++ G+Y E+++ Sbjct: 193 GIHEILFGFPYQTVRLKHESITREAFGNGVLFAARHVIEQEAGLYGMEDLM 243 Lambda K H 0.318 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 251 Length adjustment: 23 Effective length of query: 193 Effective length of database: 228 Effective search space: 44004 Effective search space used: 44004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory