Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_011763948.1 AZO_RS01095 aspartate aminotransferase family protein
Query= curated2:Q9PDF2 (411 letters) >NCBI__GCF_000061505.1:WP_011763948.1 Length = 460 Score = 162 bits (411), Expect = 1e-44 Identities = 128/413 (30%), Positives = 199/413 (48%), Gaps = 45/413 (10%) Query: 34 VW--DEQGRDYLDLAAGIAVCCLGHCDPDLVAALVEQAGRLWHTSNVFY--SEPSLRLAQ 89 VW D G++ LD AG+ +G+ +V A EQ +L + + F SEP++RLA Sbjct: 39 VWLRDIHGKEVLDAFAGLWCVNIGYGHESVVQAAAEQMRKLPYATGYFGFGSEPAIRLAA 98 Query: 90 ELVDVS-RFAERVFLCSSGTEANEAAIKLVRKWAAAQGRLPEHRTIVTFHGSFHGRTLAA 148 +L +++ + +L G+EA +AAI+L+ + A GR P+ + + +HG + Sbjct: 99 KLAEIAPKSLRHTYLTLGGSEAVDAAIRLITHYYNATGR-PQKKHFIAIERGYHGSSSVG 157 Query: 149 VTATAQPKYQEGYE-PLPGGF----------------RYVDFNHIEALEA--AMVGGD-V 188 TA P + G++ PLP + V + AL A A +G D V Sbjct: 158 SGLTALPAFHRGFDVPLPNQHYIASPYPYRSPVGDDPQAVIAASVAALRAKVAELGADNV 217 Query: 189 AAVMLEPIQGEGGVMPVVSGYLAQVRALCDRYGALLVLDEIQCGMGRTGTLFAYWQEEVV 248 AA EP+QG GGV+ G+L +R G L V+DE+ G GRTG +FA E+V Sbjct: 218 AAFFCEPVQGSGGVIVPPKGWLKAMREASRELGILFVVDEVITGFGRTGPMFACLAEDVE 277 Query: 249 PDIVTLAKGLGGGF-PIGAMLAGPKVAEVMQFGA-------HGTTFGGNPMAAAVARVAL 300 PD++T+AKGL G+ P+GA++ +V + GA HG T+ G+P++AAVA + Sbjct: 278 PDLMTMAKGLTSGYVPMGALMISDEVYNGIADGAAPNVLVGHGATYSGHPVSAAVALEVI 337 Query: 301 RKLASVEIAANVQRQSVALRAGLEEISEAFGGVFTQVRGRGLMLGAVLAPLYA------- 353 R I A+ Q AGL E+ + + VR RGL+ L A Sbjct: 338 RLYEEGGILAHAQAMEPGFAAGLGEMLD--HPLVGDVRHRGLLGAVELVADKASKRAFDP 395 Query: 354 --GQASAILEVAVEHGVLLLQAGPDVLRFVPALNVSDEELADGLVRLRAALGD 404 G A + ++G++ G +L F PAL +++ A RL+ L + Sbjct: 396 ALGLADRLFRSGYQNGLIFRSFGDHILGFAPALCFTEDNFAQLFARLKRTLDE 448 Lambda K H 0.322 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 460 Length adjustment: 32 Effective length of query: 379 Effective length of database: 428 Effective search space: 162212 Effective search space used: 162212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory