Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_011764207.1 AZO_RS02380 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000061505.1:WP_011764207.1 Length = 429 Score = 267 bits (683), Expect = 4e-76 Identities = 166/423 (39%), Positives = 231/423 (54%), Gaps = 43/423 (10%) Query: 12 DRALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQ---------GFEYSRTH 62 D + +L +H GQ PD TGA PIY T+++ SP EH G YSR Sbjct: 3 DHRFGIESLCLHAGQQPDAETGARAVPIYQTTSFVFDSP-EHAAELFNLQTFGNVYSRIS 61 Query: 63 NPTRFAYERCVAALEGGTRAFAFASGMAATST-VMELLDAGSHVVAMDDLYGGTFRLFER 121 NPT +E +AALEGG A A +SG+AA T ++ L AG +VA LYGG++ + Sbjct: 62 NPTVAVFEERMAALEGGRAALATSSGLAAQMTALLTLAQAGDEIVAARTLYGGSYSQLD- 120 Query: 122 VRRRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLL 181 V R G+ FVD +DP F+AAI TK V+ E NP L + D+AA+A I R G+ Sbjct: 121 VSLRRLGISTVFVDPSDPENFRAAITDRTKAVYGEIIGNPSLNVFDVAAVAAITRAAGVP 180 Query: 182 TVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVG-----DNAELAEQ-- 234 V+D+T ASP L RPL GAD+V+HSATKY+ GH +GG+ V DN + Sbjct: 181 LVIDSTLASPYLCRPLEHGADIVIHSATKYIGGHGTTMGGVLVESGTFPWDNGRFPQMVE 240 Query: 235 -------MAFLQ----------------NSIGGVQGPFDSFLALRGLKTLPLRMRAHCEN 271 + F + + G PF++F+ L+GL+TL +RM H N Sbjct: 241 PSPGYHGVRFYETFGNFGFTMKARMETLRTFGQALSPFNAFMLLQGLETLHVRMDRHVAN 300 Query: 272 ALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQM-SGFGGIVSIVLKGGFDAAKRFCEK 330 A A+A +L HPA+ V YPGLA+ P+H LA+R G G I+S ++GG A +RF E Sbjct: 301 ARAVADFLAAHPAVAWVNYPGLAASPEHALAQRYFPKGPGAILSFGIRGGQPAGERFIEA 360 Query: 331 TELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDLE 390 ++ + ++G ++LV HPA TH + + G+ +VRLSVGIE L D+ DL+ Sbjct: 361 LQMISHLANVGDAKTLVIHPASTTHRQLSEEEQRAAGVPPDMVRLSVGIETLDDILWDLD 420 Query: 391 RAL 393 +AL Sbjct: 421 QAL 423 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 429 Length adjustment: 31 Effective length of query: 366 Effective length of database: 398 Effective search space: 145668 Effective search space used: 145668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory