Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_011764802.1 AZO_RS05415 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000061505.1:WP_011764802.1 Length = 354 Score = 364 bits (935), Expect = e-105 Identities = 184/362 (50%), Positives = 252/362 (69%), Gaps = 9/362 (2%) Query: 4 ADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKH 63 +D+L LR +ID LDE IL ++ERARCAQ V +K + YRPEREA VL+ Sbjct: 2 SDELLNLRNQIDRLDEEILARLAERARCAQRVGEIKHGN--------IYRPEREAQVLRR 53 Query: 64 IMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKP 123 + +LN GPL + + ++FREIMS+CL LEQPL+VAYLGP GTFS++A+ KHFG + P Sbjct: 54 LADLNGGPLPDVAVQKIFREIMSACLGLEQPLKVAYLGPAGTFSESASRKHFGAAPNVLP 113 Query: 124 MAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVG 183 +IDEVFR V +G ++GVVPVENSTEGAV TLD L + + +CGEV+LRIH +LL Sbjct: 114 TPSIDEVFRAVESGNADYGVVPVENSTEGAVGGTLDLLLANPLKVCGEVKLRIHQNLL-S 172 Query: 184 ETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDM 243 R+YSHAQSLAQC +WL+ + ++ R+ V+SNA+AA+ + S AIAG+ Sbjct: 173 RAEGIGGAKRLYSHAQSLAQCHEWLNRNLAHLPRIPVASNAEAARLAAEDPESCAIAGEA 232 Query: 244 AAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPF 303 AA+LYGL+KLA IED P N+TRFL+I S + P+G+DKTS++ S +N+PGA+H LL P Sbjct: 233 AAELYGLNKLATNIEDDPNNTTRFLVIASHDAGPSGNDKTSLVCSAQNRPGAMHALLEPL 292 Query: 304 HSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKA 363 +G+D++++E+RP+RSG W YVF++D GH D + L ++ A +KVLGSYP A Sbjct: 293 ARHGVDMSKLESRPARSGLWEYVFYVDIQGHQTDAAVAAALRELNERAAFVKVLGSYPVA 352 Query: 364 VL 365 + Sbjct: 353 AI 354 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 354 Length adjustment: 29 Effective length of query: 336 Effective length of database: 325 Effective search space: 109200 Effective search space used: 109200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011764802.1 AZO_RS05415 (prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.26023.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-30 91.2 1.9 7.9e-30 89.3 1.1 2.3 2 lcl|NCBI__GCF_000061505.1:WP_011764802.1 AZO_RS05415 prephenate dehydrata Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000061505.1:WP_011764802.1 AZO_RS05415 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.3 1.1 7.9e-30 7.9e-30 1 76 [] 5 75 .. 5 75 .. 0.97 2 ? -0.6 0.0 0.088 0.088 9 30 .. 326 347 .. 323 349 .. 0.75 Alignments for each domain: == domain 1 score: 89.3 bits; conditional E-value: 7.9e-30 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkksaseaviYRPeREaavlrrlkelnkGpLdqeavari 71 L +lRn+iD +D++il l eRa++a++vge+K+ iYRPeREa+vlrrl +ln GpL++ av++i lcl|NCBI__GCF_000061505.1:WP_011764802.1 5 LLNLRNQIDRLDEEILARLAERARCAQRVGEIKHG-----NIYRPEREAQVLRRLADLNGGPLPDVAVQKI 70 678*****************************986.....99***************************** PP TIGR01807 72 frEim 76 frEim lcl|NCBI__GCF_000061505.1:WP_011764802.1 71 FREIM 75 ****9 PP == domain 2 score: -0.6 bits; conditional E-value: 0.088 TIGR01807 9 DaiDdrildLlseRaklakavg 30 Da + l+ l+eRa ++k +g lcl|NCBI__GCF_000061505.1:WP_011764802.1 326 DAAVAAALRELNERAAFVKVLG 347 55556667889****9999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.78 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory