Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate WP_011765738.1 AZO_RS10135 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >NCBI__GCF_000061505.1:WP_011765738.1 Length = 380 Score = 488 bits (1255), Expect = e-142 Identities = 234/376 (62%), Positives = 285/376 (75%) Query: 1 MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKA 60 + +T +L LA ELISR SVTP+D C +L+A+RL +GF E + G N+W RRG+ Sbjct: 3 LPDTPTLALACELISRSSVTPEDAGCLQLIAQRLAPLGFVCERIDIGGVSNLWARRGSAR 62 Query: 61 PVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKH 120 P++CFAGHTDVVPTGP++ W SPPFEP RDG LYGRGAADMK+S+A FVTA ERFVA H Sbjct: 63 PLLCFAGHTDVVPTGPLDAWQSPPFEPTIRDGHLYGRGAADMKSSLAGFVTAIERFVAAH 122 Query: 121 PNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRR 180 P+H GSIALL+TSDEEG A GT KVV+ L AR E +DYC+VGEPT+V LGDMIKNGRR Sbjct: 123 PDHAGSIALLLTSDEEGVATCGTVKVVEALAARGERLDYCVVGEPTSVKTLGDMIKNGRR 182 Query: 181 GSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNING 240 GSLSG L VKG+QGH+AYPHLA NP+H APAL EL E WD+GNE+FPPT++Q+SNI+ Sbjct: 183 GSLSGTLRVKGRQGHVAYPHLARNPIHELAPALAELAAERWDDGNEFFPPTTWQVSNIHA 242 Query: 241 GTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTQAG 300 GTGA NVIPG +V FNFRF + ST LK R HAILD+HG+ Y+L W SG+PF+T G Sbjct: 243 GTGANNVIPGVCDVLFNFRFGSVSTADALKARTHAILDRHGLDYELDWHLSGKPFITGRG 302 Query: 301 KLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLND 360 +L AI ET G+E ELSTTGGTSDGRFI I E++E GP NA+IHQ+NE++ ++ Sbjct: 303 QLVAALGNAIRETVGVETELSTTGGTSDGRFIADICAEVVEFGPVNASIHQVNEHIAVDA 362 Query: 361 IPKLSAVYEGILARLL 376 + LS +YE L LL Sbjct: 363 VEPLSKIYERTLRALL 378 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 380 Length adjustment: 30 Effective length of query: 351 Effective length of database: 350 Effective search space: 122850 Effective search space used: 122850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_011765738.1 AZO_RS10135 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.12117.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-167 542.9 0.0 2.1e-167 542.7 0.0 1.0 1 lcl|NCBI__GCF_000061505.1:WP_011765738.1 AZO_RS10135 succinyl-diaminopime Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000061505.1:WP_011765738.1 AZO_RS10135 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 542.7 0.0 2.1e-167 2.1e-167 2 369 .. 9 376 .. 8 377 .. 0.99 Alignments for each domain: == domain 1 score: 542.7 bits; conditional E-value: 2.1e-167 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaG 70 l+la+eLisr svtP+dag+++lia+rL lgf +e++ ++++ nlwa+rg +p l+faGhtDvvP+G lcl|NCBI__GCF_000061505.1:WP_011765738.1 9 LALACELISRSSVTPEDAGCLQLIAQRLAPLGFVCERIDIGGVSNLWARRGSARPLLCFAGHTDVVPTG 77 5799***************************************************************** PP TIGR01246 71 elekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtk 139 +l++W+s+pfep++rdG+lygrGaaDmk+sla fv+a erfv++++dh Gs++ll+tsDeeg a Gt+ lcl|NCBI__GCF_000061505.1:WP_011765738.1 78 PLDAWQSPPFEPTIRDGHLYGRGAADMKSSLAGFVTAIERFVAAHPDHAGSIALLLTSDEEGVATCGTV 146 ********************************************************************* PP TIGR01246 140 kvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvl 208 kvve l +r e +dy+vvgeP+svk+lGD+ik+GrrGs++g+l++kG qGhvaYPh+a+nP+h+++p+l lcl|NCBI__GCF_000061505.1:WP_011765738.1 147 KVVEALAARGERLDYCVVGEPTSVKTLGDMIKNGRRGSLSGTLRVKGRQGHVAYPHLARNPIHELAPAL 215 ********************************************************************* PP TIGR01246 209 keliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkl 277 +el+a+++D+Gneffpp+ q++ni+agtga+nviPg +v fn+rf s ++++ lk + ++ild+h+l lcl|NCBI__GCF_000061505.1:WP_011765738.1 216 AELAAERWDDGNEFFPPTTWQVSNIHAGTGANNVIPGVCDVLFNFRFGSVSTADALKARTHAILDRHGL 284 ********************************************************************* PP TIGR01246 278 dYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihk 346 dYel+w+lsg+pf+t +g+l++++ +ai+e+++ ++elst+GGtsD+rfia++ aevve+G+vn++ih+ lcl|NCBI__GCF_000061505.1:WP_011765738.1 285 DYELDWHLSGKPFITGRGQLVAALGNAIRETVGVETELSTTGGTSDGRFIADICAEVVEFGPVNASIHQ 353 ********************************************************************* PP TIGR01246 347 vneavkiedleklsevyekllee 369 vne++ ++ +e ls++ye++l+ lcl|NCBI__GCF_000061505.1:WP_011765738.1 354 VNEHIAVDAVEPLSKIYERTLRA 376 ******************99976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (380 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.18 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory