Align Serine O-succinyltransferase; SST; Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.-; EC 2.3.1.46 (characterized)
to candidate WP_011778808.1 MVAN_RS07820 homoserine O-acetyltransferase
Query= SwissProt::S2KHP1 (367 letters) >NCBI__GCF_000015305.1:WP_011778808.1 Length = 375 Score = 214 bits (544), Expect = 4e-60 Identities = 127/356 (35%), Positives = 192/356 (53%), Gaps = 14/356 (3%) Query: 12 GPVRMYRGGELPSVTIAYETWGELRGQGDNALLLFTGLSPSAHAASSMAD--PSPGWWEY 69 GP+ + G + V+IA + WGEL + DN +++ L+ +H P+PGWW+ Sbjct: 25 GPLTLENGEVIDDVSIAVQRWGELSARRDNVVVVLHALTGDSHITGPAGPDHPTPGWWDG 84 Query: 70 MIGPGKPIDTERFFVIAINSLGSCFGSTGPASINPATGQPYRLDFPKLSVEDIVAAARGA 129 + GPG PIDT+R+ I+ N LG C GSTGP+S+ P G+ + FP +S+ D VAA A Sbjct: 85 VAGPGAPIDTDRWCAISTNVLGGCRGSTGPSSLAP-DGKAWGSRFPTISIRDQVAADVAA 143 Query: 130 CRALGIDHVHTVAGASLGGMDALAYAVMYPGTYRDIISISAAAHATPFTIALRSIQREAV 189 GI V V G S+GG AL + +++P + R + ++ A AT I + Q A+ Sbjct: 144 LERFGITEVAAVIGGSMGGARALEWMMLHPDSVRAALVLAVGARATADQIGTQCTQVAAI 203 Query: 190 RADPAWAGGNY-APGEGPKDGMRVARQLGILTYRSAEEWLQRFDRERLEGSDDSANPFAM 248 ++DP W GG+Y G P G+ +AR+ LTYR E +RF + G D + Sbjct: 204 KSDPNWRGGDYHGTGRSPDHGLEIARRFAHLTYRGETELDERFGNDAQPGEDPATGG--- 260 Query: 249 AFQVQSYMEANARKFADRFDANCYLYLSQAMDLFDMAEHGDGSLEAAVRRIDAKRALVAG 308 + VQSY+E RK RFDA Y+ L+ A+ D+ G G + AA++ +V G Sbjct: 261 RYSVQSYLEHQGRKLLARFDAGTYVTLTDALSSHDIG-RGRGGVAAALQSCPVP-TVVGG 318 Query: 309 VTTDWLFPLWQQRQVAELLEHA-GVAVSYHELGSIQGHDAFLVDSERFAPMVAEFL 363 +T+D L+PL Q ++AELL G+ V + S GHD FLV+++ ++ L Sbjct: 319 ITSDRLYPLRLQAELAELLPGCDGLDV----VDSACGHDGFLVETDAVGKLIRRTL 370 Lambda K H 0.320 0.135 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 375 Length adjustment: 30 Effective length of query: 337 Effective length of database: 345 Effective search space: 116265 Effective search space used: 116265 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory