Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) (characterized)
to candidate WP_011781671.1 MVAN_RS22700 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Query= BRENDA::P9WP21 (317 letters) >NCBI__GCF_000015305.1:WP_011781671.1 Length = 318 Score = 520 bits (1338), Expect = e-152 Identities = 258/318 (81%), Positives = 287/318 (90%), Gaps = 4/318 (1%) Query: 4 VTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRT 63 +T A+GIG+AT+AADGSVLDTWFPAPELT+ G + T RL+V++VP ELAAL GRD+DR Sbjct: 1 MTSASGIGVATIAADGSVLDTWFPAPELTDGGEAGTVRLSVAEVPAELAALAGRDEDRDV 60 Query: 64 ETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCA 123 + + VRTVI SLDD A D YDAYLRLHLLSHRLVAPHGLNA GLFGVLTNVVWT+HGPCA Sbjct: 61 DVVVVRTVIASLDDKAVDAYDAYLRLHLLSHRLVAPHGLNADGLFGVLTNVVWTSHGPCA 120 Query: 124 IDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHE 183 +DGFE VRARLRRRG V VYGVDKFPRMVDYV+P+GVRIADADRVRLGAHLAPGTTVMHE Sbjct: 121 VDGFETVRARLRRRGHVAVYGVDKFPRMVDYVLPSGVRIADADRVRLGAHLAPGTTVMHE 180 Query: 184 GFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLLGAN 243 GFVN+NAGTLG+SMVEGRISAGVVV DGSDVGGGASIMGTLSGGGT VIS+GKRCLLGAN Sbjct: 181 GFVNFNAGTLGSSMVEGRISAGVVVDDGSDVGGGASIMGTLSGGGTQVISVGKRCLLGAN 240 Query: 244 SGLGISLGDDCVVEAGLYVTAGTRVTMPD----SNSVKARELSGSSNLLFRRNSVSGAVE 299 +GLGISLGDDCV+EAGLYVTAGT+VT+ D + +VKARELSG++NLLFRRNSV+GAVE Sbjct: 241 AGLGISLGDDCVIEAGLYVTAGTKVTLLDGDRTATTVKARELSGANNLLFRRNSVTGAVE 300 Query: 300 VLARDGQGIALNEDLHAN 317 V+ RDG GI LNE LHAN Sbjct: 301 VVKRDGTGITLNEALHAN 318 Lambda K H 0.318 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 318 Length adjustment: 27 Effective length of query: 290 Effective length of database: 291 Effective search space: 84390 Effective search space used: 84390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_011781671.1 MVAN_RS22700 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
to HMM TIGR03535 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03535.hmm # target sequence database: /tmp/gapView.26347.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03535 [M=320] Accession: TIGR03535 Description: DapD_actino: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-165 534.3 13.0 5.1e-165 534.2 13.0 1.0 1 lcl|NCBI__GCF_000015305.1:WP_011781671.1 MVAN_RS22700 2,3,4,5-tetrahydrop Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015305.1:WP_011781671.1 MVAN_RS22700 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransfe # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 534.2 13.0 5.1e-165 5.1e-165 1 320 [] 2 318 .] 2 318 .] 0.98 Alignments for each domain: == domain 1 score: 534.2 bits; conditional E-value: 5.1e-165 TIGR03535 1 rsalglGlatvtadgtvldvWypelelgeaaeagterleae..leelaalagedeargvervvvttkia 67 +sa g+G+at++adg+vld+W+p++el++ eagt rl+++ ++elaalag+de+r+v++vvv+t+ia lcl|NCBI__GCF_000015305.1:WP_011781671.1 2 TSASGIGVATIAADGSVLDTWFPAPELTDGGEAGTVRLSVAevPAELAALAGRDEDRDVDVVVVRTVIA 70 589*********************************99987789************************* PP TIGR03535 68 dldeapadaadaylrlhllshrlvkPntvnldGifgllanvvWtnlGPvavedlektraklraegpvtv 136 +ld++++da+daylrlhllshrlv P+++n dG+fg+l+nvvWt++GP+av+++e++ra+lr++g+v v lcl|NCBI__GCF_000015305.1:WP_011781671.1 71 SLDDKAVDAYDAYLRLHLLSHRLVAPHGLNADGLFGVLTNVVWTSHGPCAVDGFETVRARLRRRGHVAV 139 ********************************************************************* PP TIGR03535 137 ysvdkfPrmvdyvvPtgvrigdadrvrlGaylaeGttvmheGfvnfnaGtlGasmveGrisaGvvvgdG 205 y+vdkfPrmvdyv+P+gvri+dadrvrlGa+la GttvmheGfvnfnaGtlG+smveGrisaGvvv+dG lcl|NCBI__GCF_000015305.1:WP_011781671.1 140 YGVDKFPRMVDYVLPSGVRIADADRVRLGAHLAPGTTVMHEGFVNFNAGTLGSSMVEGRISAGVVVDDG 208 ********************************************************************* PP TIGR03535 206 sdiGGGasimGtlsGGGkevisiGercllGansGvGislGddcvveaGlyvtaGtkvtlvdkakeaag. 273 sd+GGGasimGtlsGGG++vis+G+rcllGan+G+GislGddcv+eaGlyvtaGtkvtl+d g lcl|NCBI__GCF_000015305.1:WP_011781671.1 209 SDVGGGASIMGTLSGGGTQVISVGKRCLLGANAGLGISLGDDCVIEAGLYVTAGTKVTLLD------Gd 271 ***********************************************************44......43 PP TIGR03535 274 eegevvkaaelsGasnllfrrnsvsGaveavarkgkaielnealhan 320 +++++vka+elsGa+nllfrrnsv+Gave+v+r+g++i+lnealhan lcl|NCBI__GCF_000015305.1:WP_011781671.1 272 RTATTVKARELSGANNLLFRRNSVTGAVEVVKRDGTGITLNEALHAN 318 56789****************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (320 nodes) Target sequences: 1 (318 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.09 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory