Align Histidinol-phosphate aminotransferase 1; EC 2.6.1.9; Imidazole acetol-phosphate transaminase 1 (uncharacterized)
to candidate WP_011782728.1 MVAN_RS28225 aminotransferase
Query= curated2:Q5QZ49 (367 letters) >NCBI__GCF_000015305.1:WP_011782728.1 Length = 351 Score = 212 bits (540), Expect = 1e-59 Identities = 123/322 (38%), Positives = 183/322 (56%), Gaps = 6/322 (1%) Query: 39 VKLASNENPLGLSEKVKTALEAELTDLVRYPDANGYY-LKSRLAELNEVGTQQITLGNGS 97 +K+ASNE G V+ A+E + + RYPD NGY L+ RLA+ + I++G GS Sbjct: 25 IKIASNETVHGPLPSVRAAIEKAIDGINRYPD-NGYVELRERLAKHVNFAPEYISVGCGS 83 Query: 98 NDVLEILARTFVSDKDEVIFSQHAFVVYPLVTQAIGAKPVAVPAVDYGHDLDGMAKAVTD 157 + + L + + DEV+F +F +YPL + GA PV VP D+ DLD M A+TD Sbjct: 84 VSLCQQLIQITSTVGDEVLFGWRSFEIYPLQVRTAGATPVQVPLTDHTFDLDAMLAAITD 143 Query: 158 KTKMIFIANPNNPTGTFLSTSALKSFLDKIPQHIIVVLDEAYYEYVPEDQRAPSVEWIKE 217 +T++IF+ NPNNPT T + AL F++ +P HI+VV+DEAY EY+ + S ++ Sbjct: 144 RTRLIFVCNPNNPTSTVVDPDALARFVEAVPPHIMVVVDEAYVEYIRDGLAPDSFGLVRA 203 Query: 218 YPNLVVSRTFSKAYGLAGLRAGYAVSHESVADVLNRIRQPFNMNSLSLKAAEVVLDDHAY 277 + N+VV RTFSKAYGLAGLR GYAV+ + L+++ PF S+S AA LD Sbjct: 204 HSNVVVLRTFSKAYGLAGLRIGYAVADPDIIAALSKVYVPFTATSVSQAAAIACLDAADE 263 Query: 278 LQKAVELNAQGMQLLTEFCEESGLNYIPSYGNFLTIEVGPGAEKLYDELLHEGVIVRPVG 337 L + + ++ E+G + PS NF+ + + A++ + + VIVRP G Sbjct: 264 LLERTDAVVAERTRVSAALREAGYDLPPSQANFVWLPLVGRAQQFAADAANSRVIVRPYG 323 Query: 338 GYELPNHLRVSIGLPEENQAFI 359 + +RV+I P EN AF+ Sbjct: 324 ----EDGVRVTIAAPHENDAFL 341 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 351 Length adjustment: 29 Effective length of query: 338 Effective length of database: 322 Effective search space: 108836 Effective search space used: 108836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_011782728.1 MVAN_RS28225 (aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.25202.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-88 280.4 0.0 1.1e-87 280.1 0.0 1.0 1 lcl|NCBI__GCF_000015305.1:WP_011782728.1 MVAN_RS28225 aminotransferase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015305.1:WP_011782728.1 MVAN_RS28225 aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 280.1 0.0 1.1e-87 1.1e-87 1 344 [. 6 342 .. 6 346 .. 0.96 Alignments for each domain: == domain 1 score: 280.1 bits; conditional E-value: 1.1e-87 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylg 69 r+++ +l +Y pg ++ + +k +snE +gp ++v++a++++++ ++rYpd+ +el+e+lak+++ lcl|NCBI__GCF_000015305.1:WP_011782728.1 6 RPELADLPAYAPG---KTVPGAIKIASNETVHGPLPSVRAAIEKAIDGINRYPDNGYVELRERLAKHVN 71 6789999*****8...333468*********************************************** PP TIGR01141 70 veeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavle 138 + +e i +g+Gs l + li+ + + gd+vl+ ++++Y++ +++aga ++vpl+++ + dl+a+l+ lcl|NCBI__GCF_000015305.1:WP_011782728.1 72 FAPEYISVGCGSVSLCQQLIQITSTVGDEVLFGWRSFEIYPLQVRTAGATPVQVPLTDH-TFDLDAMLA 139 ***********************************************************.479999999 PP TIGR01141 139 aakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypnlv 203 a++++++l+f+++PnnPt ++++ + + +++e+v + +VVvDeAY+e+ ++ ++ + l++ ++n+v lcl|NCBI__GCF_000015305.1:WP_011782728.1 140 AITDRTRLIFVCNPNNPTSTVVDPDALARFVEAVpPHIMVVVDEAYVEYIRDglaPDSFGLVRAHSNVV 208 **********************************66****************999************** PP TIGR01141 204 vlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkerer 272 vlrT+SKa+gLAglR+Gya+a+++ii al+kv p+ +s++++aa+a l+ +d++ +++++v +er+r lcl|NCBI__GCF_000015305.1:WP_011782728.1 209 VLRTFSKAYGLAGLRIGYAVADPDIIAALSKVYVPFTATSVSQAAAIACLDAADELLERTDAVVAERTR 277 ********************************************************************* PP TIGR01141 273 lleelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtreener 341 + ++l++ g + +S+aNFv + + a++++ + ++++ivR ++ + +R+t+ ++en++ lcl|NCBI__GCF_000015305.1:WP_011782728.1 278 VSAALREA-GYDLPPSQANFVWLPLVGRAQQFAADAANSRVIVRPYGE------DGVRVTIAAPHENDA 339 ********.8***************99******************983......458************ PP TIGR01141 342 lle 344 +l lcl|NCBI__GCF_000015305.1:WP_011782728.1 340 FLG 342 996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.50 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory