Align threonine deaminase (EC 4.3.1.19) (characterized)
to candidate WP_011799546.1 PNAP_RS00550 threonine ammonia-lyase
Query= reanno::Caulo:CCNA_03750 (400 letters) >NCBI__GCF_000015505.1:WP_011799546.1 Length = 400 Score = 405 bits (1041), Expect = e-117 Identities = 201/393 (51%), Positives = 278/393 (70%) Query: 3 LDLAAIQAAAGRLQGQIERTPCRHSKTLSKITGAEVWVKFENLQFTAAYKERGALNKLML 62 L L I+ AA RL G + TPC S+TLS++TGA++++KFENLQ+TA++KERGA NKL Sbjct: 2 LSLTVIEQAAQRLHGHLLDTPCVESRTLSQLTGAQIYLKFENLQYTASFKERGACNKLAQ 61 Query: 63 LSETEKQRGVIAASAGNHAQGLAYHGARLGVPVTIVMPKTTPFVKVQHTRDFGATVVIEG 122 L+E+E+QRGVIA SAGNHAQG+AYH RLG+ IVMP+ TP VK++ TR FGA VV+ G Sbjct: 62 LTESERQRGVIAMSAGNHAQGVAYHAQRLGIRAVIVMPRFTPGVKIERTRGFGAEVVLHG 121 Query: 123 ETYDDANAHARKLRDEQGLTFVHPFDDYDIMAGQGTIALEMLEDAPDLEILPVPIGGGGL 182 +T D + AHA L + + L FVHP+DD I+AGQGT+ LEML P+LE+L + +GGGGL Sbjct: 122 DTLDASRAHAMGLAEREKLVFVHPYDDEAIVAGQGTVGLEMLHAVPELEVLVIAVGGGGL 181 Query: 183 ISGVATAAKALKPDIRIIGCEPAMYPSFTAKMRGVAAHCGGQTIAEGVAVKQVGELTYGV 242 I+GVATAAKALKP I IIG + + +P+ ++G G TIA+G+AV G + + Sbjct: 182 IAGVATAAKALKPGIEIIGVQTSRFPAMVNAIKGTHHPQGTSTIADGIAVGTPGVIAQAI 241 Query: 243 VRPLLDDVLLLEEPYLEQAVSLYCNVEKTIAEGAGAASLAALLAYPERFRGKKCGLILCG 302 + +DD+LL++E +EQA+ + +EKT+ EGAGAA LAALL YP RF G+K GL+LCG Sbjct: 242 IAEKVDDLLLVDEGDIEQAMVMLLEIEKTLVEGAGAAGLAALLKYPARFAGRKVGLVLCG 301 Query: 303 GNIDTRLLASVLTRELVRAQRLASLRIIGDDRPGLLSTVASVIGAMGANIIEVNHNRLAL 362 GNID LLA+++ R +VRA RLA +R+ D PG L+ + + + GANI EV+H R Sbjct: 302 GNIDPLLLAAIIERGMVRAGRLARIRVSARDIPGSLAKITATVADAGANIEEVHHQRAFT 361 Query: 363 DVPAKGAEFDITIETRDAQHTQEVMEALRESGY 395 + A+ E ++ ++TR H +V++ALR +G+ Sbjct: 362 MLAAQNVEIELVLQTRGRPHIAQVLQALRTAGF 394 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 400 Length adjustment: 31 Effective length of query: 369 Effective length of database: 369 Effective search space: 136161 Effective search space used: 136161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_011799546.1 PNAP_RS00550 (threonine ammonia-lyase)
to HMM TIGR01127 (ilvA: threonine ammonia-lyase (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01127.hmm # target sequence database: /tmp/gapView.4914.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01127 [M=380] Accession: TIGR01127 Description: ilvA_1Cterm: threonine ammonia-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-135 437.1 5.6 3.1e-135 437.0 5.6 1.0 1 lcl|NCBI__GCF_000015505.1:WP_011799546.1 PNAP_RS00550 threonine ammonia-l Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015505.1:WP_011799546.1 PNAP_RS00550 threonine ammonia-lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.0 5.6 3.1e-135 3.1e-135 1 378 [. 21 396 .. 21 398 .. 0.98 Alignments for each domain: == domain 1 score: 437.0 bits; conditional E-value: 3.1e-135 TIGR01127 1 tpleksstlsditgaevylklenlqktGsfkirGalnkiaklseeekkrGvvaasaGnhaqGvalaakv 69 tp s tls++tga++ylk enlq t sfk rGa nk+a+l+e e++rGv+a saGnhaqGva+ a++ lcl|NCBI__GCF_000015505.1:WP_011799546.1 21 TPCVESRTLSQLTGAQIYLKFENLQYTASFKERGACNKLAQLTESERQRGVIAMSAGNHAQGVAYHAQR 89 78999**************************************************************** PP TIGR01127 70 fgikakivmPesaplskvkatksyGaeviLhGadfDeayklaeelaeeegrvfvhafdDefviaGqGtl 138 gi+a+ivmP+++p k++ t+++Gaev+LhG+++D + ++a lae+e +vfvh++dDe ++aGqGt+ lcl|NCBI__GCF_000015505.1:WP_011799546.1 90 LGIRAVIVMPRFTPGVKIERTRGFGAEVVLHGDTLDASRAHAMGLAEREKLVFVHPYDDEAIVAGQGTV 158 ********************************************************************* PP TIGR01127 139 gleiledlpdvdtvivPvGGGGLisGvasavkklnpevkviGveaeaapslveslkegkikavesvkti 207 gle+l+ +p+++++++ vGGGGLi+Gva+a+k l+p++ +iGv++ p++v+++k ++ + ++ti lcl|NCBI__GCF_000015505.1:WP_011799546.1 159 GLEMLHAVPELEVLVIAVGGGGLIAGVATAAKALKPGIEIIGVQTSRFPAMVNAIKGT--HHPQGTSTI 225 ******************************************************9865..4567899** PP TIGR01127 208 aDGiavkkpgdltfeivkelvDevvavdeeeiakaillLlerakivaegaGavgvaavleekvdvkgkk 276 aDGiav +pg ++ i+ e vD+++ vde +i +a+++Lle +k+++egaGa+g+aa+l+ g+k lcl|NCBI__GCF_000015505.1:WP_011799546.1 226 ADGIAVGTPGVIAQAIIAEKVDDLLLVDEGDIEQAMVMLLEIEKTLVEGAGAAGLAALLKYPARFAGRK 294 ********************************************************************* PP TIGR01127 277 vavvvsGGnidlnllekiiekgLvksgrkvkietvlkDkPGaLkklleviaekranivkiehdrlskei 345 v++v++GGnid+ ll iie+g+v+ gr+++i++ D+PG+L k+++++a+++ani +++h+r + + lcl|NCBI__GCF_000015505.1:WP_011799546.1 295 VGLVLCGGNIDPLLLAAIIERGMVRAGRLARIRVSARDIPGSLAKITATVADAGANIEEVHHQRAFTML 363 ********************************************************************* PP TIGR01127 346 algaakvelelevkgkehleellktlrdkgyev 378 a ++el l+++g+ h+ ++l+ lr g+e lcl|NCBI__GCF_000015505.1:WP_011799546.1 364 AAQNVEIELVLQTRGRPHIAQVLQALRTAGFEA 396 *******************************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (380 nodes) Target sequences: 1 (400 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory