Align imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) (characterized)
to candidate WP_011800112.1 PNAP_RS03455 imidazoleglycerol-phosphate dehydratase
Query= reanno::BFirm:BPHYT_RS17700 (195 letters) >NCBI__GCF_000015505.1:WP_011800112.1 Length = 206 Score = 298 bits (764), Expect = 3e-86 Identities = 147/194 (75%), Positives = 164/194 (84%) Query: 2 RLAEVVRNTSETQIRVKINLDGTGQQKLATGVPFLDHMLDQIARHGLFDLEIEAHGDLHI 61 R AEV RNT+ET+I VK+NLDGTGQ L+TG+ F DHMLDQIARHGL DL+I A GDLHI Sbjct: 13 RTAEVSRNTAETKITVKLNLDGTGQASLSTGIGFFDHMLDQIARHGLIDLDIHAVGDLHI 72 Query: 62 DDHHTVEDTGITLGQAVAKAIGDRKGIVRYGHSYVPLDEALSRVVIDFSGRPGLEFHVPF 121 D HHTVED GITLGQAVA+A+GD+KG+ RYGH+YVPLDEALSRVV+DFSGRPGL +VPF Sbjct: 73 DGHHTVEDVGITLGQAVAQAVGDKKGLRRYGHAYVPLDEALSRVVVDFSGRPGLVMNVPF 132 Query: 122 TRARIGTFDVDLSIEFFRGFVNHAGVTLHIDNLRGLNAHHQMETVFKAFGRALRMATELD 181 IGTFD L+ EFF+GFVNHA VTLHIDNL+G NAHHQ ETVFKAF RALRMA E+D Sbjct: 133 KSGMIGTFDSQLAYEFFQGFVNHAFVTLHIDNLKGENAHHQAETVFKAFARALRMALEID 192 Query: 182 ERAAGQIPSTKGSL 195 RAA IPSTKGSL Sbjct: 193 PRAANVIPSTKGSL 206 Lambda K H 0.323 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 195 Length of database: 206 Length adjustment: 21 Effective length of query: 174 Effective length of database: 185 Effective search space: 32190 Effective search space used: 32190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory