Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate WP_011800310.1 PNAP_RS04470 ribose-phosphate pyrophosphokinase
Query= SwissProt::P0A1V6 (315 letters) >NCBI__GCF_000015505.1:WP_011800310.1 Length = 324 Score = 402 bits (1034), Expect = e-117 Identities = 204/313 (65%), Positives = 252/313 (80%), Gaps = 2/313 (0%) Query: 2 PDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCA 61 PD +F GNA P +A I L TSLG A VG+FSDGEV+V+I +NVR D+F++QSTCA Sbjct: 4 PDFLVFTGNANPSMAAEITQHLGTSLGVAHVGQFSDGEVTVEIQQNVRTRDVFVVQSTCA 63 Query: 62 PTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVG 121 PTNDNLMEL+VMVDAL+RASA RITAVIPYFGYARQDRR RSARVPITAKVVA+ L +VG Sbjct: 64 PTNDNLMELLVMVDALKRASAERITAVIPYFGYARQDRRPRSARVPITAKVVANMLQAVG 123 Query: 122 VDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIA 181 V VLT+DLHA+QIQGFFD+PVDN++ SPILL D+ Q + +VVSPD+GGVVRARA+A Sbjct: 124 VTSVLTMDLHADQIQGFFDIPVDNIYASPILLGDLRQRKYTDLMVVSPDVGGVVRARALA 183 Query: 182 KLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGA 241 K L DMAIIDKRRP+ANVS+VMH+IGD+ GR+CV++DDMIDT GTL KAAE LKERGA Sbjct: 184 KQLG-CDMAIIDKRRPKANVSEVMHVIGDIEGRNCVIMDDMIDTAGTLVKAAEVLKERGA 242 Query: 242 KRVFAYATHPIFSGNAANNL-RNSVIDEVVVCDTIPLTDEIKALPNVRTLTLSGMLAEAI 300 K+V+AY THPIFSG A + + +DEVVV +TIPL +A +R L+++ ++AE I Sbjct: 243 KKVYAYCTHPIFSGPAIDRITHGDALDEVVVTNTIPLNPNAQACKKIRQLSVAPLIAETI 302 Query: 301 RRISNEESISAMF 313 +RI+ ES+ ++F Sbjct: 303 QRIAKGESVMSLF 315 Lambda K H 0.322 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 324 Length adjustment: 28 Effective length of query: 287 Effective length of database: 296 Effective search space: 84952 Effective search space used: 84952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_011800310.1 PNAP_RS04470 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.23317.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-127 410.4 1.3 2.2e-127 410.2 1.3 1.0 1 lcl|NCBI__GCF_000015505.1:WP_011800310.1 PNAP_RS04470 ribose-phosphate py Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015505.1:WP_011800310.1 PNAP_RS04470 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.2 1.3 2.2e-127 2.2e-127 3 309 .] 8 316 .. 6 316 .. 0.98 Alignments for each domain: == domain 1 score: 410.2 bits; conditional E-value: 2.2e-127 TIGR01251 3 ilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellll 71 ++ g++++++a+++ ++lg++lg ++v +F+dgE+ v+i+++vr +dvf++ qst+ap+nd+lmell++ lcl|NCBI__GCF_000015505.1:WP_011800310.1 8 VFTGNANPSMAAEITQHLGTSLGVAHVGQFSDGEVTVEIQQNVRTRDVFVV-QSTCAPTNDNLMELLVM 75 799************************************************.***************** PP TIGR01251 72 idalkrasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqiqgfFdvp 139 +dalkrasa+++taviPy+gYaRqd++ + r pi+ak+va++l+++G+++vlt+dlH++qiqgfFd+p lcl|NCBI__GCF_000015505.1:WP_011800310.1 76 VDALKRASAERITAVIPYFGYARQDRRPRsARVPITAKVVANMLQAVGVTSVLTMDLHADQIQGFFDIP 144 **************************97758************************************** PP TIGR01251 140 venlsaspklieelkkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdv 208 v+n++asp l+ +l++++ ++l+vvsPD G+v ra+++ak+lg+++aii+K+R+ k+n+ ev++++gd+ lcl|NCBI__GCF_000015505.1:WP_011800310.1 145 VDNIYASPILLGDLRQRKYTDLMVVSPDVGGVVRARALAKQLGCDMAIIDKRRP-KANVSEVMHVIGDI 212 ******************************************************.899*********** PP TIGR01251 209 egkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeag.veevivtntilv.e 275 eg+++vi+DD+i+T+gTlvkaae+Lke+GAkkv++++th++fsg+A+ r+++ ++ev+vtnti+ lcl|NCBI__GCF_000015505.1:WP_011800310.1 213 EGRNCVIMDDMIDTAGTLVKAAEVLKERGAKKVYAYCTHPIFSGPAIDRITHGDaLDEVVVTNTIPLnP 281 ***************************************************99879***********74 PP TIGR01251 276 e.kklpkvseisvapliaeaiarihenesvsslfd 309 + ++++k++++svapliae+i ri+++esv slf+ lcl|NCBI__GCF_000015505.1:WP_011800310.1 282 NaQACKKIRQLSVAPLIAETIQRIAKGESVMSLFS 316 469******************************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 6.96 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory