Align aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_011800963.1 PNAP_RS07800 amino acid aminotransferase
Query= BRENDA::P04693 (397 letters) >NCBI__GCF_000015505.1:WP_011800963.1 Length = 398 Score = 395 bits (1016), Expect = e-115 Identities = 204/397 (51%), Positives = 260/397 (65%), Gaps = 1/397 (0%) Query: 1 MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQP 60 +F V+ DPIL L E+F D KVNL +G+YY+++G +P L+ V AE ++ P Sbjct: 3 LFTAVEMAPRDPILGLNEQFAADTNPAKVNLGVGVYYDDNGKLPLLECVQAAEKQMMEAP 62 Query: 61 HGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFP 120 YLP++G+ Y A+ L+FGAD + RVAT+Q +GG+G LKVGADFLK P Sbjct: 63 KARG-YLPIDGIAAYDAAVKGLVFGADSEPVTSGRVATVQCIGGTGGLKVGADFLKHLNP 121 Query: 121 ESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHP 180 + V +SDP+WENH A+F AGF V +YP+YD AT G+ F +LA L PA +IV+LH Sbjct: 122 NAKVLISDPSWENHRALFTNAGFTVESYPYYDAATRGINFAGMLAALNAAPAGTIVVLHA 181 Query: 181 CCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPAL 240 CCHNPTG D+T QWD V+ +KA L+ FLD+AYQGFG G+ ED I +AGL Sbjct: 182 CCHNPTGYDITAAQWDEVVAAVKANNLVAFLDMAYQGFGYGLAEDGAVIGKFVAAGLNFF 241 Query: 241 VSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLN 300 VS SFSK FSLYGERVGGLSV+CE E AGRVL QLK +R NYS+PP G VVA VL+ Sbjct: 242 VSTSFSKSFSLYGERVGGLSVLCESKEEAGRVLSQLKIVIRTNYSNPPIHGGMVVAMVLD 301 Query: 301 DEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVD 360 L+A W E+ EMR RI AMRQ+LV L + + ++ Q GMFSY+GLS Q+ Sbjct: 302 TPELRALWEKELGEMRVRIKAMRQKLVDGLKAAGVKEDMSFITKQIGMFSYSGLSKDQMV 361 Query: 361 RLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397 RLR EFGVY +GRMCVA LN+ N+ V + A V+ Sbjct: 362 RLRNEFGVYGTDTGRMCVAALNSKNIDYVCASIAKVI 398 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 398 Length adjustment: 31 Effective length of query: 366 Effective length of database: 367 Effective search space: 134322 Effective search space used: 134322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory