Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate WP_011801201.1 PNAP_RS09060 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >NCBI__GCF_000015505.1:WP_011801201.1 Length = 406 Score = 434 bits (1115), Expect = e-126 Identities = 226/402 (56%), Positives = 272/402 (67%), Gaps = 31/402 (7%) Query: 4 TQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEEL-----HFGDTKNIWLR--- 55 +++L LA++LISRPSVTPDD CQ LL RL +GF E + HF T N+W + Sbjct: 2 SRTLHLAEQLISRPSVTPDDAGCQALLIARLAPLGFKCETIVSGPEHFRVT-NLWAKFEG 60 Query: 56 ----------------------RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGR 93 K + FAGHTDVVPTGP+ +W S PF P+ R G+ Sbjct: 61 FSPSAQAALAQPAIESIANTELSQAKVKTLVFAGHTDVVPTGPLAQWHSHPFTPSHRAGK 120 Query: 94 LYGRGAADMKTSIACFVTACERFVAKHPNHQGSIALLITSDEEGDALDGTTKVVDVLKAR 153 LYGRG ADMKTSIA V A E F+A HP S+A LITSDEEG +DGT V D L AR Sbjct: 121 LYGRGTADMKTSIAAMVVAVEEFLAAHPRPALSMAFLITSDEEGPGIDGTVVVCDRLLAR 180 Query: 154 DELIDYCIVGEPTAVDKLGDMIKNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPAL 213 E++DYCIVGEPT+V +LGDMIKNGRRG+LSG L+VKG QGHIAYPHLA NP+H FAPAL Sbjct: 181 GEVLDYCIVGEPTSVKQLGDMIKNGRRGTLSGKLSVKGVQGHIAYPHLAKNPIHLFAPAL 240 Query: 214 LELTQEVWDEGNEYFPPTSFQISNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRV 273 EL WD+GN++FP TS+Q+SNI+ GTGA+NVIPG+L V FNFRF TEST L+QR+ Sbjct: 241 AELVATQWDQGNDFFPATSWQVSNIHAGTGASNVIPGDLVVDFNFRFCTESTPESLQQRL 300 Query: 274 HAILDKHGVQYDLQWSCSGQPFLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIK 333 AIL KH +Y+L+W+ G PFLT G L D R AI G++ ELSTTGGTSDGRFI Sbjct: 301 LAILSKHQFEYELKWTLGGLPFLTTPGTLVDAVRGAILAETGVQTELSTTGGTSDGRFIA 360 Query: 334 AIAQELIELGPSNATIHQINENVRLNDIPKLSAVYEGILARL 375 I ++IELGP NATIHQINE V + L +Y+G+L RL Sbjct: 361 KICPQVIELGPVNATIHQINECVDTASLDPLKNIYKGVLERL 402 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 406 Length adjustment: 31 Effective length of query: 350 Effective length of database: 375 Effective search space: 131250 Effective search space used: 131250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_011801201.1 PNAP_RS09060 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.23989.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-152 491.8 0.0 7.3e-151 488.3 0.0 1.9 1 lcl|NCBI__GCF_000015505.1:WP_011801201.1 PNAP_RS09060 succinyl-diaminopim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015505.1:WP_011801201.1 PNAP_RS09060 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 488.3 0.0 7.3e-151 7.3e-151 2 370 .] 5 402 .. 4 402 .. 0.97 Alignments for each domain: == domain 1 score: 488.3 bits; conditional E-value: 7.3e-151 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefe....dtknlwatrgt............. 53 l+la++Lisr+svtP+dag+q+l+++rL lgf++e++ + ++nlwa+ + lcl|NCBI__GCF_000015505.1:WP_011801201.1 5 LHLAEQLISRPSVTPDDAGCQALLIARLAPLGFKCETIVSGpehfRVTNLWAKFEGfspsaqaalaqpa 73 689**********************************9877333357899997544599999******* PP TIGR01246 54 ............eepvlvfaGhtDvvPaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaer 110 + ++lvfaGhtDvvP+G+l +W+s+pf+p++r GklygrG+aDmk+s+aa+vva+e+ lcl|NCBI__GCF_000015505.1:WP_011801201.1 74 iesiantelsqaKVKTLVFAGHTDVVPTGPLAQWHSHPFTPSHRAGKLYGRGTADMKTSIAAMVVAVEE 142 ********99887889***************************************************** PP TIGR01246 111 fvkknadhkGslsllitsDeegeaidGtkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsit 179 f+++++ s+++litsDeeg idGt+ v + l +r e +dy++vgeP+svk+lGD+ik+GrrG ++ lcl|NCBI__GCF_000015505.1:WP_011801201.1 143 FLAAHPRPALSMAFLITSDEEGPGIDGTVVVCDRLLARGEVLDYCIVGEPTSVKQLGDMIKNGRRGTLS 211 ********************************************************************* PP TIGR01246 180 gklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppsslqianieagtgasnviPgelk 248 gkl++kG+qGh+aYPh+a+nP+h ++p+l+el+a+++D+Gn+ffp++s q++ni+agtgasnviPg+l lcl|NCBI__GCF_000015505.1:WP_011801201.1 212 GKLSVKGVQGHIAYPHLAKNPIHLFAPALAELVATQWDQGNDFFPATSWQVSNIHAGTGASNVIPGDLV 280 ********************************************************************* PP TIGR01246 249 vkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikkvaeaieevlkkkpelst 317 v fn+rf++e++ e+l++++ +il kh+ +Yel+w+l g pflt g l+++v+ ai ++ ++elst lcl|NCBI__GCF_000015505.1:WP_011801201.1 281 VDFNFRFCTESTPESLQQRLLAILSKHQFEYELKWTLGGLPFLTTPGTLVDAVRGAILAETGVQTELST 349 ********************************************************************* PP TIGR01246 318 sGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 +GGtsD+rfiak+ +v+elG+vn+tih++ne+v + l+ l+++y+ +le+l lcl|NCBI__GCF_000015505.1:WP_011801201.1 350 TGGTSDGRFIAKICPQVIELGPVNATIHQINECVDTASLDPLKNIYKGVLERL 402 **************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.04 # Mc/sec: 3.39 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory