Align Dihydroxy-acid dehydratase 2; DAD 2; EC 4.2.1.9 (uncharacterized)
to candidate WP_011802359.1 PNAP_RS14935 phosphogluconate dehydratase
Query= curated2:Q5YX61 (629 letters) >NCBI__GCF_000015505.1:WP_011802359.1 Length = 613 Score = 236 bits (601), Expect = 3e-66 Identities = 193/592 (32%), Positives = 274/592 (46%), Gaps = 78/592 (13%) Query: 35 KPVVAVANSFTEFVPGHTHLQPVGRIVGDAIRR-------AGGIPREFNTIAVDDGIAMG 87 +P + + S+ + + HT L ++ D R+ AGG+P A+ DG+ G Sbjct: 67 RPNIGIVTSYNDMLSAHTPLLSYPALIKDEARKHGATAQVAGGVP------AMCDGVTQG 120 Query: 88 HQGMLYSLPSRDLIADSIEYMVQAHCADALVCISNCDKITPGMLLAAMRLD-IPTVFVSG 146 GM SL SRD+IA + DA + + CDKI PG+L+ A++ +P VFV Sbjct: 121 TSGMELSLFSRDVIAMGTAVALSHDMFDAALLLGVCDKIVPGLLIGALQFGHLPMVFVPA 180 Query: 147 GPMEGGRATLADGTVRRLDLITAMSEAVNDATSDADLATIEENACPTCGSCAGMFTANSM 206 GPM G +R A DA + +L + G+C TANS Sbjct: 181 GPMPSGLPNKEKARIREQ---AAQGLVGRDALLEGELKSYHSP-----GTCTFYGTANSN 232 Query: 207 NCLVEALGLALPGNGTTLATHTARRDLYEAAGATIMAITR-RYYDRDDATVLPRAIASRA 265 L+EA+GL +PG R +L A T++ IT+ + + V RAI Sbjct: 233 QMLMEAMGLHVPGTAFVQPGDMLRDELTREAARTVLGITKSKRFAPIGHVVDERAIV--- 289 Query: 266 AFDNAMALDLAMGGSTNTVLHLLAAAHEAGLDYTLADIEKRSRAVPCLCKVAPNGSHLME 325 NAM LA GGSTN ++H +A A AG+ D S VP L V PNGS + Sbjct: 290 ---NAMVALLATGGSTNHLIHWVAVAQSAGIVIDWNDFSALSDVVPLLTHVYPNGSADVN 346 Query: 326 DVHRAGGIPAILGELRRGGHLHTTVRAVHSESLDGWLAEWDVRGPNPAQAAVDLFHAAPG 385 AGG ++ EL G +H V V + G + E+ A+V A Sbjct: 347 QFQAAGGPGLVIRELLDAGFMHEDVLTVRA----GGIREY---------ASVPALEGA-- 391 Query: 386 GVRSATAFSQSARWAALDLDAESGCIRDVAHAYSEDGGLAVLRGNLAVDGAVVKSAGVPA 445 + W A+ + +R +S GGL +L GNL +V+K + VP Sbjct: 392 ----------ALAWHAVGDSKDEAIVRPAGRPFSATGGLKLLTGNLG--RSVIKVSAVPD 439 Query: 446 DLHVFTGEAVVAESQEEAVTAVLSGRVR--------PGTVLVIRYEGPR--GGPGMQEML 495 D HV A V +SQE+ + A SG + G V V+R++GP+ G P + ++ Sbjct: 440 DRHVIEAPARVFDSQEDLLLAFNSGELERLCNETAARGVVCVVRWQGPQANGMPELHKLT 499 Query: 496 YPTAYLKGRGLAGSVAVVTDGRFSGGSSGLSIG-HVSPEAAAGGTIAAVTDGDPITIDIP 554 P A L+G+G VA+VTDGR SG S + HVSPEAAAGG +A V DGD + +D Sbjct: 500 PPLAVLQGKGF--MVALVTDGRMSGASGKVPAAIHVSPEAAAGGPLAKVVDGDVVRVDAL 557 Query: 555 SRTLRLEVDDAEIARRLAH------RRRTGYRPRSRHRPLSTALRAYALLAQ 600 + LR+ VD+AE A R A RR+ G R L T +R +AL A+ Sbjct: 558 TGELRVLVDEAEWAARPASIMPDELRRQNGV---GMGRGLFTGMRRHALTAE 606 Lambda K H 0.319 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1001 Number of extensions: 61 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 629 Length of database: 613 Length adjustment: 37 Effective length of query: 592 Effective length of database: 576 Effective search space: 340992 Effective search space used: 340992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory