Align Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 (characterized)
to candidate WP_011802413.1 PNAP_RS15215 aspartate-semialdehyde dehydrogenase
Query= SwissProt::Q51344 (370 letters) >NCBI__GCF_000015505.1:WP_011802413.1 Length = 379 Score = 495 bits (1274), Expect = e-145 Identities = 246/370 (66%), Positives = 289/370 (78%), Gaps = 5/370 (1%) Query: 5 GLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSIDELK 64 GL+GWRGMVGSVL+ RM E DF+LIEPVFF+TSN GG+ P ++ LKDA+ I+ LK Sbjct: 9 GLVGWRGMVGSVLIDRMQAEGDFELIEPVFFSTSNAGGKAPAQARNETTLKDAFDIEALK 68 Query: 65 TLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKVIDQALD 124 D+ILT QGGDYT+EVFPKLR AGW G+WIDAAS+LRM DDAVIVLDPVN VI AL Sbjct: 69 KCDIILTAQGGDYTAEVFPKLRAAGWTGHWIDAASTLRMNDDAVIVLDPVNLPVIKNALT 128 Query: 125 AGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMGAAHA 184 G N++GGNCTVS MLM +G L+ AGLVEWM++MTYQAASG GAQ+MRELL Q G ++ Sbjct: 129 KGGNNWVGGNCTVSCMLMGVGALYKAGLVEWMTSMTYQAASGGGAQHMRELLTQFGTLNS 188 Query: 185 SVADDLANPASAILDIDRKVAETLRS-EAFPTEHFGAPLGGSLIPWIDKELPNGQSREEW 243 V L +P SAIL+IDR++ +S A T +FG PLGGSLIPWIDK+L +G S+EEW Sbjct: 189 EVKSLLDDPKSAILEIDRRILAKQQSLSALETANFGVPLGGSLIPWIDKDLGDGMSKEEW 248 Query: 244 KAQAETNKILARFKN----PIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQH 299 K AETNKIL + + PVDG CVR+GAMRCHSQALT KL KDVPL DIE +I+ Sbjct: 249 KGGAETNKILGQGASFGTAETPVDGFCVRIGAMRCHSQALTFKLKKDVPLADIEAMIAAD 308 Query: 300 NPWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEP 359 N WVK++PN RE S+R+LTP AVTGT+ +PVGRLRKL MG YLGAFTVGDQLLWGAAEP Sbjct: 309 NAWVKVIPNTREASIRDLTPVAVTGTMQIPVGRLRKLAMGPDYLGAFTVGDQLLWGAAEP 368 Query: 360 LRRMLRILLE 369 LRRMLRIL+E Sbjct: 369 LRRMLRILIE 378 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 379 Length adjustment: 30 Effective length of query: 340 Effective length of database: 349 Effective search space: 118660 Effective search space used: 118660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_011802413.1 PNAP_RS15215 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01745.hmm # target sequence database: /tmp/gapView.22215.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01745 [M=366] Accession: TIGR01745 Description: asd_gamma: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-180 585.8 0.1 1.8e-180 585.6 0.1 1.0 1 lcl|NCBI__GCF_000015505.1:WP_011802413.1 PNAP_RS15215 aspartate-semialdeh Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015505.1:WP_011802413.1 PNAP_RS15215 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 585.6 0.1 1.8e-180 1.8e-180 3 366 .] 8 377 .. 6 377 .. 0.96 Alignments for each domain: == domain 1 score: 585.6 bits; conditional E-value: 1.8e-180 TIGR01745 3 vglvgwrgmvgsvllkrmqeekdfdaikpvffstsqlgqkapslakisailedaydidalkeldiiitc 71 glvgwrgmvgsvl++rmq e df++i+pvffsts++g+kap+ a+ +++l+da+di+alk++dii+t lcl|NCBI__GCF_000015505.1:WP_011802413.1 8 TGLVGWRGMVGSVLIDRMQAEGDFELIEPVFFSTSNAGGKAPAQARNETTLKDAFDIEALKKCDIILTA 76 69******************************************************************* PP TIGR01745 72 qggdytkeiypklrkagwkgywidaasslrmkddaviildpvnldvikdavnkgirtfvggnctvslll 140 qggdyt e++pklr+agw g+widaas+lrm+ddavi+ldpvnl vik+a++kg +++vggnctvs +l lcl|NCBI__GCF_000015505.1:WP_011802413.1 77 QGGDYTAEVFPKLRAAGWTGHWIDAASTLRMNDDAVIVLDPVNLPVIKNALTKGGNNWVGGNCTVSCML 145 ********************************************************************* PP TIGR01745 141 mslgglfrdelvewvsvatyqaasgggarhmrellkqmgvlykeveeelakpssaileierkvtklsrs 209 m++g l++ +lvew++++tyqaasggga+hmrell+q+g+l ev++ l p sailei+r++ +s lcl|NCBI__GCF_000015505.1:WP_011802413.1 146 MGVGALYKAGLVEWMTSMTYQAASGGGAQHMRELLTQFGTLNSEVKSLLDDPKSAILEIDRRILAKQQS 214 *************************************************************98665555 PP TIGR01745 210 .eelpvenfsvplagslipwidkqldngqsreewkgqaetnkilgt.....kdtilvdglcvrigalrc 272 + l + nf+vpl gslipwidk+l +g s+eewkg aetnkilg + +vdg cvriga+rc lcl|NCBI__GCF_000015505.1:WP_011802413.1 215 lSALETANFGVPLGGSLIPWIDKDLGDGMSKEEWKGGAETNKILGQgasfgTAETPVDGFCVRIGAMRC 283 2789****************************************862111123469************* PP TIGR01745 273 hsqaltiklkkdvsleeieeiirahnkwvkvvpnereitlreltpaavtgtldipvgrlrklnmgkeyl 341 hsqalt+klkkdv+l +ie +i+a+n wvkv+pn re ++r+ltp avtgt++ipvgrlrkl mg++yl lcl|NCBI__GCF_000015505.1:WP_011802413.1 284 HSQALTFKLKKDVPLADIEAMIAADNAWVKVIPNTREASIRDLTPVAVTGTMQIPVGRLRKLAMGPDYL 352 ********************************************************************* PP TIGR01745 342 saftvgdqllwgaaeplrrmlrill 366 aftvgdqllwgaaeplrrmlril+ lcl|NCBI__GCF_000015505.1:WP_011802413.1 353 GAFTVGDQLLWGAAEPLRRMLRILI 377 ***********************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (366 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.73 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory