Align Putative (R)-citramalate synthase CimA; EC 2.3.3.21 (uncharacterized)
to candidate WP_011813096.1 HHAL_RS01440 homocitrate synthase
Query= curated2:Q8TYM1 (509 letters) >NCBI__GCF_000015585.1:WP_011813096.1 Length = 381 Score = 265 bits (676), Expect = 3e-75 Identities = 163/365 (44%), Positives = 208/365 (56%), Gaps = 3/365 (0%) Query: 14 VRIFDTTLRDGEQTPGVALTPEEKLRIARKLDEIGVDTIEAGFAAASEGELKAIRRIARE 73 V I DTTLRDGEQ+ GVA T EKL IA LD IGV +E G A E IR +A Sbjct: 4 VVIDDTTLRDGEQSAGVAFTRAEKLAIAAALDRIGVPELEVGIPAMGPEERADIRALAES 63 Query: 74 ELDAEVCSMARMVKGDVDAAVEAEADAVHIVVPTSEVHVKKKLRMDREEVLERAREVVEY 133 + A + ARM + D+ A V +P S+ + KL DR VL R V Sbjct: 64 GVSARLLVWARMRETDLQACGGLGVWGVDGSIPVSDQQIAHKLGRDRRWVLGRIDAWVRR 123 Query: 134 ARDHGLTVEISTEDGTRTELEYLYEVFDACLEAGAERLGYNDTVGVMAPEGMFLAVKKLR 193 AR GL V + ED TR + E+L EV AGA RL DTVG+ P + ++LR Sbjct: 124 ARVQGLEVSVGGEDATRADPEFLVEVARCAEAAGARRLRIADTVGIAEPFAVCEVFQRLR 183 Query: 194 ERVGEDVILSVHCHDDFGMATANTVAAVRAGARQVHVTVNGIGERAGNAALEEVVVVLEE 253 D+ L +H HDDFG+ATAN++AAVR GA V+ TV G+GERAGNAALEEVV+ L Sbjct: 184 --AATDLELEMHAHDDFGLATANSLAAVRGGATHVNTTVCGLGERAGNAALEEVVLGLHR 241 Query: 254 LYGVDTGIRTERLTELSKLVERLTGVRVPPNKAVVGENAFTHESGIHADGILKDESTYEP 313 L TG+ T LT ++ LVE +G VP K+VVG F HE+GIH DG+LKD Y+ Sbjct: 242 LCHRPTGVDTAGLTAVAALVEAASGRPVPWGKSVVGAGVFRHEAGIHVDGLLKDARNYQG 301 Query: 314 IPPEKVGHERRFVLGKHVGTSVIRKKLKQMGVDVDDEQLLEILRRLKRLGDRGKRITEAD 373 + P++VG VLGKH GT ++ ++ GVD+D EQ +L ++R KR AD Sbjct: 302 LDPDEVGRCHELVLGKHSGTRGVQAACREAGVDLDREQARALLPLIRRWSVTHKRAPSAD 361 Query: 374 -LRAI 377 LRA+ Sbjct: 362 ELRAL 366 Lambda K H 0.315 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 381 Length adjustment: 32 Effective length of query: 477 Effective length of database: 349 Effective search space: 166473 Effective search space used: 166473 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory