Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate WP_011813997.1 HHAL_RS06105 diaminopimelate decarboxylase
Query= BRENDA::Q9KVL7 (417 letters) >NCBI__GCF_000015585.1:WP_011813997.1 Length = 418 Score = 419 bits (1077), Expect = e-122 Identities = 213/407 (52%), Positives = 284/407 (69%), Gaps = 2/407 (0%) Query: 11 QLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAVKANSNLGVLN 70 +LWAE +PL +LA ++GTP YVYSRA +E W + ++G +CYAVKAN NL +L Sbjct: 13 RLWAEALPLDELAERFGTPCYVYSRAAIEERWALYRSALGVAGD-VCYAVKANGNLALLQ 71 Query: 71 TLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIKCFNVESEPE 130 LAR G+GFDIVS GELERVL AGGD ++VVFSGVGK E++RALQ I+CFNVES E Sbjct: 72 LLARHGAGFDIVSGGELERVLHAGGDAARVVFSGVGKGTDEIRRALQAGIRCFNVESAAE 131 Query: 131 LQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAAQVYRLAHSLP 190 L+R+ VA AP++LR+NPDV+ +THPYI+TGL +KFGI + A +Y A + P Sbjct: 132 LERIASVAATENTPAPVALRVNPDVNPETHPYIATGLAQSKFGIALEEAEALYLQAANDP 191 Query: 191 NLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGGLGVVYRDELP 250 L+V GI CHIGSQL ++AP +A +RL AL L+ +GI + H+D GGGLGV Y DE P Sbjct: 192 RLEVRGIACHIGSQLLSVAPLTEAAERLAALARRLQEQGISLDHIDAGGGLGVHYIDEQP 251 Query: 251 PQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHKNFAIIDAAMN 310 P P+E+ +A+ L R + ++ EPGRAI A AG+L+T++E+LKH K FAI+DA MN Sbjct: 252 PTPAEHIEAISAPL-RDLGVSVLVEPGRAIVAEAGILLTRIEYLKHNGGKEFAIVDAGMN 310 Query: 311 DLIRPALYQAWQDIIPLRPRQGEAQTYDLVGPVCETSDFLGKDRDLVLQEGDLLAVRSSG 370 D +RPALY A + + P + E + D+VGPVCE++D +D L G LLA+RS+G Sbjct: 311 DYLRPALYDAAHTLEAVTPSEAELRPVDVVGPVCESADTFARDCTLPAAAGGLLAIRSAG 370 Query: 371 AYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVLPE 417 AYG M+S YN RPR EV+VDG + +L+R+RE + L + ES+LPE Sbjct: 371 AYGAVMASQYNARPRPPEVLVDGTQAHLIRRRETIDELMSGESLLPE 417 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 418 Length adjustment: 32 Effective length of query: 385 Effective length of database: 386 Effective search space: 148610 Effective search space used: 148610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011813997.1 HHAL_RS06105 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.12400.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-153 495.1 0.0 7.4e-153 494.9 0.0 1.0 1 lcl|NCBI__GCF_000015585.1:WP_011813997.1 HHAL_RS06105 diaminopimelate dec Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015585.1:WP_011813997.1 HHAL_RS06105 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 494.9 0.0 7.4e-153 7.4e-153 8 416 .. 13 412 .. 8 413 .. 0.98 Alignments for each domain: == domain 1 score: 494.9 bits; conditional E-value: 7.4e-153 TIGR01048 8 eleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgl 76 +l++e+ +l elae+fgtP Yvy++++++er++ +++a + + v+YAvKAn nla+l+lla++G+g+ lcl|NCBI__GCF_000015585.1:WP_011813997.1 13 RLWAEALPLDELAERFGTPCYVYSRAAIEERWALYRSALGVA-GDVCYAVKANGNLALLQLLARHGAGF 80 689999*********************************864.68************************ PP TIGR01048 77 dvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvl 145 d+vsgGEler+l+Ag +a ++vfsg+gk ++e+++al+++i+++nv+s +ele++ ++a+ ++ a+v+ lcl|NCBI__GCF_000015585.1:WP_011813997.1 81 DIVSGGELERVLHAGGDAARVVFSGVGKGTDEIRRALQAGIRCFNVESAAELERIASVAATENTPAPVA 149 ********************************************************************* PP TIGR01048 146 lRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaek 214 lRvnpdv+++th+yi+TGl++sKFGi++eeae+ y +a++++ le+ Gi +HIGSq+l ++p++eaae+ lcl|NCBI__GCF_000015585.1:WP_011813997.1 150 LRVNPDVNPETHPYIATGLAQSKFGIALEEAEALYLQAANDPRLEVRGIACHIGSQLLSVAPLTEAAER 218 ********************************************************************* PP TIGR01048 215 vvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklklilEpGRslv 283 ++ l+++l+e+gi+l ++d+GGGlg++y +e+ +p+++e e++ + l++ l +++++EpGR++v lcl|NCBI__GCF_000015585.1:WP_011813997.1 219 LAALARRLQEQGISLDHIDAGGGLGVHYIDEQ-PPTPAEHIEAISAPLRD-----LGVSVLVEPGRAIV 281 ******************************99.***************99.....799*********** PP TIGR01048 284 anagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvGplCEsgDv 352 a+ag+lltr+e++K+++ ++f++vDagmnd +RpalY+a h + a+ + +e+e vdvvGp+CEs+D+ lcl|NCBI__GCF_000015585.1:WP_011813997.1 282 AEAGILLTRIEYLKHNGGKEFAIVDAGMNDYLRPALYDAAHTLEAV-TPSEAELRPVDVVGPVCESADT 349 **********************************************.668888**************** PP TIGR01048 353 lakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledllale 416 +a+d +lp++ G lla++saGAYga m+s+Yn+rprp evlv++ +a+lirrret+++l++ e lcl|NCBI__GCF_000015585.1:WP_011813997.1 350 FARDCTLPAAA-GGLLAIRSAGAYGAVMASQYNARPRPPEVLVDGTQAHLIRRRETIDELMSGE 412 ********998.************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (418 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.02 # Mc/sec: 7.71 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory