Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate WP_011814258.1 HHAL_RS07430 succinyldiaminopimelate transaminase
Query= metacyc::MONOMER-6501 (397 letters) >NCBI__GCF_000015585.1:WP_011814258.1 Length = 399 Score = 337 bits (863), Expect = 5e-97 Identities = 192/397 (48%), Positives = 240/397 (60%), Gaps = 9/397 (2%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 MN L L PYPFE++ LL G+ PI L IGEP+ P + + + NL ++ Sbjct: 1 MNRGLSELQPYPFERMERLLT--GRRAGPAAPIRLGIGEPQDPPPELLTRVLRDNLDQVA 58 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIP--APDPESEVLPVLGSREALFAFAQTVIDPSAGA 118 YP+T+G +LR+AI+ WL RRY +P A +P+ VLPV G+REALFA AQTVI Sbjct: 59 RYPATRGLESLREAIAGWLRRRYRLPEAAINPDEHVLPVAGTREALFAIAQTVIGRGR-P 117 Query: 119 LVVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNP 178 V PNPFYQIYEGAALL+GA P Y+ +P + W+R QL+++ SP NP Sbjct: 118 YVAMPNPFYQIYEGAALLSGARPLYLPIEPGSGLP-DLDAIEPRTWQRVQLLYLNSPANP 176 Query: 179 AGNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLV 238 G V + +R + EL DR+GF+IAA ECYSEIY DE PP G LQ + GR + + Sbjct: 177 TGAVADSDYYRRVLELCDRYGFIIAADECYSEIYADEANPPPGLLQVCQAEGRADFHRCL 236 Query: 239 AFSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAW-SMRRMCR 297 F SLSKRSN PG+RSGFVAGD L+ FL YRTY G A+ V AAS AAW + Sbjct: 237 VFHSLSKRSNAPGLRSGFVAGDPGLIHAFLRYRTYQGCALPLHVQAASAAAWRDEAHVIE 296 Query: 298 KTAQYRAKFEAVLPILQNVLD-VRAPQASFYLWAGTPGSDTAFARELYGRTGVTVLPGSL 356 A+YR ++E V IL LD V P A+FYLW TP D F R L+ VTVLPGS Sbjct: 297 NRARYRERYEEVCTILAEALDEVAPPPATFYLWPRTPIDDQTFTRRLWEEENVTVLPGSF 356 Query: 357 LAREAHNAN-PGQGRIRIALVAPLDQCVQAAERIAHF 392 L+R + PG GRIR+ALV L C++AAERI F Sbjct: 357 LSRPGGDGTPPGAGRIRMALVPDLATCIEAAERIRRF 393 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 609 Number of extensions: 39 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 399 Length adjustment: 31 Effective length of query: 366 Effective length of database: 368 Effective search space: 134688 Effective search space used: 134688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_011814258.1 HHAL_RS07430 (succinyldiaminopimelate transaminase)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.20499.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-173 562.5 0.0 2.6e-173 562.3 0.0 1.0 1 lcl|NCBI__GCF_000015585.1:WP_011814258.1 HHAL_RS07430 succinyldiaminopime Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015585.1:WP_011814258.1 HHAL_RS07430 succinyldiaminopimelate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 562.3 0.0 2.6e-173 2.6e-173 1 395 [] 1 394 [. 1 394 [. 0.97 Alignments for each domain: == domain 1 score: 562.3 bits; conditional E-value: 2.6e-173 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkGlpe 69 mn l++l+pyPfe++++ll++ + +i+l iGeP+ ++P++++ +l++nl+++++yP+t+Gl++ lcl|NCBI__GCF_000015585.1:WP_011814258.1 1 MNRGLSELQPYPFERMERLLTGRRAGPA-APIRLGIGEPQDPPPELLTRVLRDNLDQVARYPATRGLES 68 89********************988877.89************************************** PP TIGR03538 70 lreaiaeWlerrfelpag.vdperqvlPvnGtrealfafvqavidraekalvvlPnPfyqiyeGaalla 137 lreaia Wl+rr++lp+ ++p+++vlPv Gtrealfa++q+vi r +++v +PnPfyqiyeGaall+ lcl|NCBI__GCF_000015585.1:WP_011814258.1 69 LREAIAGWLRRRYRLPEAaINPDEHVLPVAGTREALFAIAQTVIGRG-RPYVAMPNPFYQIYEGAALLS 136 *****************99*************************986.69******************* PP TIGR03538 138 gaepyflnctaengfkpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklleladkydfiiasde 206 ga+p +l+ ++ +g pd+da++ +W+rvqll+++sP nPtGav + + ++++lel d+y+fiia+de lcl|NCBI__GCF_000015585.1:WP_011814258.1 137 GARPLYLPIEPGSG-LPDLDAIEPRTWQRVQLLYLNSPANPTGAVADSDYYRRVLELCDRYGFIIAADE 204 *********99885.7***************************************************** PP TIGR03538 207 cyselyldeaeaPvGlleaaaelGrddfkrllvfhslskrsnvPGlrsGfvaGdaellkeflryrtyhG 275 cyse+y+dea++P Gll+++++ Gr df+r+lvfhslskrsn+PGlrsGfvaGd l+++flryrty+G lcl|NCBI__GCF_000015585.1:WP_011814258.1 205 CYSEIYADEANPPPGLLQVCQAEGRADFHRCLVFHSLSKRSNAPGLRSGFVAGDPGLIHAFLRYRTYQG 273 ********************************************************************* PP TIGR03538 276 campiavqlasiaaWedekhvrenralyrekfaavleilgavld.lelPdasfylWlkvpdgddeafar 343 ca+p++vq+as aaW de+hv+enra+yre+++ v +il++ ld + P a+fylW+++ ++dd++f+r lcl|NCBI__GCF_000015585.1:WP_011814258.1 274 CALPLHVQAASAAAWRDEAHVIENRARYRERYEEVCTILAEALDeVAPPPATFYLWPRT-PIDDQTFTR 341 *****************************************997478899*********.5******** PP TIGR03538 344 alyeeenvkvlpGrylsrea.egvnPGegrvrlalvaeleecveaaerikkll 395 +l+eeenv+vlpG++lsr +g+ PG+gr+r+alv +l++c+eaaeri++++ lcl|NCBI__GCF_000015585.1:WP_011814258.1 342 RLWEEENVTVLPGSFLSRPGgDGTPPGAGRIRMALVPDLATCIEAAERIRRFV 394 ******************97256789************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (399 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.39 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory