Align histidinol-phosphatase (EC 3.1.3.15) (characterized)
to candidate WP_011814582.1 HHAL_RS09060 inositol monophosphatase
Query= BRENDA::P95189 (260 letters) >NCBI__GCF_000015585.1:WP_011814582.1 Length = 269 Score = 83.6 bits (205), Expect = 4e-21 Identities = 71/239 (29%), Positives = 107/239 (44%), Gaps = 14/239 (5%) Query: 3 HDDLMLALALADRADELTRVRFGALD-LRIDTKPDLTPVTDADRAVESDVRQTLGRDRPG 61 H + +A+ A +L LD +++++K V D DR E+ + QT+ R P Sbjct: 2 HPMVNIAVRAARAGGDLIVRNIDRLDRVQVESKGRYDFVCDIDRQAEAAIVQTIQRAYPQ 61 Query: 62 DGVLGEEFG---GSTTFTGRQWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSVGVVSAP 118 +L EE G + + WI+DP+DGT NF+RG P IA+ ++ + P Sbjct: 62 HAILAEEGGLQGHAQSKAEYTWIIDPLDGTANFLRGYPHIGVSIAVQKEDQLEAAAIYDP 121 Query: 119 ALQRRWWAARGRGAFASVDGAR---PHRLSVSSVAELHSASLSFSSLSGWARPGLRERFI 175 Q + A+RG G A +DG R P R SV F + P F Sbjct: 122 LRQELFTASRGNG--AQLDGRRIRVPQRRSVDGA----MIGTGFPFKNQALMPAYLRMFS 175 Query: 176 GLTDTVWRVRAYGD-FLSYCLVAEGAVDIAAEPQVSVWDLAALDIVVREAGGRLTSLDG 233 +T+ +R G L VA G +D E + WD+A ++VREAGG +T + G Sbjct: 176 AVTEHAEDMRRAGSAALDLAYVAAGRLDGYFELGLKPWDIAGGTLLVREAGGIVTDITG 234 Lambda K H 0.319 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 269 Length adjustment: 25 Effective length of query: 235 Effective length of database: 244 Effective search space: 57340 Effective search space used: 57340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory