Align Acetylornithine deacetylase; AO; Acetylornithinase; N-acetylornithinase; NAO; EC 3.5.1.16 (characterized)
to candidate WP_011814831.1 HHAL_RS10330 acetylornithine deacetylase
Query= SwissProt::P23908 (383 letters) >NCBI__GCF_000015585.1:WP_011814831.1 Length = 389 Score = 314 bits (804), Expect = 3e-90 Identities = 170/383 (44%), Positives = 222/383 (57%), Gaps = 7/383 (1%) Query: 6 PPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPVPGTRNKFNML 65 P E+ L+A PS+S+ E DQ N + LA W + LGF+ +QP+PG +K N++ Sbjct: 6 PALREMIAELVAEPSVSSVEADHDQGNRGITERLAGWLEGLGFDCRIQPLPGRPDKTNLI 65 Query: 66 ASI----GQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFIL 121 A++ G GGL L GHTDTVP D RWT DP+ L E DG+LYGLG DMK F A + Sbjct: 66 ATLAPARGPARGGLALCGHTDTVPCDPERWTGDPWRLREADGRLYGLGVTDMKAFLAVAV 125 Query: 122 DALRDVDVTKLKKPLYILATADEETSMAGARYF--AETTALRPDCAIIGEPTSLQPVRAH 179 +A R+VD +L+ PL +L TADEE+ M G R A L P A++GEPT PV H Sbjct: 126 EAAREVDPARLQAPLTLLFTADEESGMDGVRALLDAHPQGLGPRHAVVGEPTRNHPVHVH 185 Query: 180 KGHISNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKERYHYEAFTVPYPTL 239 KG + A+ IQG++GHSSDP G NA++ M + ++ R+ L +H F VP PTL Sbjct: 186 KGMMMEALHIQGRAGHSSDPRLGRNALDAMTRVLNALIAWREELAANHHDARFAVPQPTL 245 Query: 240 NLGHIHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAPVSERWPGRLTVDELH 299 NLGHI GGD NRIC ELH+D+RPLPGM EL L+ LA LT L Sbjct: 246 NLGHIRGGDNPNRICGEAELHIDLRPLPGMDPAELQQTLDRRLAEALGDDAVHLTRRPLF 305 Query: 300 PPIPGYECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTL-CPTLVLGPGSINQAHQPD 358 P P P + ++V E + G V + TEAP++ L +VLGPG I QAHQPD Sbjct: 306 PAHPPMATPADAEVVRYAETVTGHPAGAVAFATEAPYLARLGMDVVVLGPGEIEQAHQPD 365 Query: 359 EYLETRFIKPTRELITQVIHHFC 381 E ++ + PT L+ + IH FC Sbjct: 366 ESIDVERLAPTVALLRRFIHRFC 388 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 483 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 389 Length adjustment: 30 Effective length of query: 353 Effective length of database: 359 Effective search space: 126727 Effective search space used: 126727 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_011814831.1 HHAL_RS10330 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.29217.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-118 381.8 0.0 2e-118 381.6 0.0 1.0 1 lcl|NCBI__GCF_000015585.1:WP_011814831.1 HHAL_RS10330 acetylornithine dea Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015585.1:WP_011814831.1 HHAL_RS10330 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 381.6 0.0 2e-118 2e-118 2 364 .. 11 383 .. 10 384 .. 0.98 Alignments for each domain: == domain 1 score: 381.6 bits; conditional E-value: 2e-118 TIGR01892 2 ilakLvafdsvsar......snvdlieyvedyleelgvavevlpvadgaeksnllaviGpkeg..aggl 62 ++a+Lva +svs n + e ++++le lg+ + +p ++ +k+nl+a+ p++g +ggl lcl|NCBI__GCF_000015585.1:WP_011814831.1 11 MIAELVAEPSVSSVeadhdqGNRGITERLAGWLEGLGFDCRIQPLPGRPDKTNLIATLAPARGpaRGGL 79 7899********998999999***************************************9765589** PP TIGR01892 63 vlsGhtDvvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDe 131 +l GhtD+vP+d ++Wt Dp+rL+e dgrLYg+G +Dmk Fla++++a+++++ a+L++Pl l+++aDe lcl|NCBI__GCF_000015585.1:WP_011814831.1 80 ALCGHTDTVPCDPERWTGDPWRLREADGRLYGLGVTDMKAFLAVAVEAAREVDPARLQAPLTLLFTADE 148 ********************************************************************* PP TIGR01892 132 evglaGakklieala..rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaak 198 e g+ G++ l++a + p++a+vGePt+ ++v hkG++ +++++Gr ghss+p G +a +++ lcl|NCBI__GCF_000015585.1:WP_011814831.1 149 ESGMDGVRALLDAHPqgLGPRHAVVGEPTRNHPVHVHKGMMMEALHIQGRAGHSSDPRLGRNALDAMTR 217 **************98889************************************************** PP TIGR01892 199 llarlvaladklkredleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallek 267 +l+ l+a +++l ++++ F +p +tln+G+++GG+ n+i+++ el+++lRp+pGmdp+el++ l lcl|NCBI__GCF_000015585.1:WP_011814831.1 218 VLNALIAWREELAANHHDARFAVPQPTLNLGHIRGGDNPNRICGEAELHIDLRPLPGMDPAELQQTLDR 286 ********************************************************************9 PP TIGR01892 268 iaeevkekapgfevkveelsatpaleleedaelvalleklaGaaaevvsygteagllqelGieavvlGP 336 ++e+ + ++ + +a+p +++++dae+v+ +e ++G++a +v+++tea++l +lG++ vvlGP lcl|NCBI__GCF_000015585.1:WP_011814831.1 287 RLAEALGDDAVHLTRRPLFPAHPPMATPADAEVVRYAETVTGHPAGAVAFATEAPYLARLGMDVVVLGP 355 999999999999999****************************************************** PP TIGR01892 337 GdidqahqpdeYveieelkrcrallerl 364 G+i+qahqpde +++e l ++ all+r lcl|NCBI__GCF_000015585.1:WP_011814831.1 356 GEIEQAHQPDESIDVERLAPTVALLRRF 383 *************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.96 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory