Align threonine deaminase (EC 4.3.1.19) (characterized)
to candidate WP_011840691.1 RSPH17029_RS04715 threonine/serine dehydratase
Query= reanno::Caulo:CCNA_03750 (400 letters) >NCBI__GCF_000015985.1:WP_011840691.1 Length = 325 Score = 188 bits (477), Expect = 2e-52 Identities = 119/320 (37%), Positives = 169/320 (52%), Gaps = 11/320 (3%) Query: 4 DLAAIQAAAGRLQGQIERTPCRHSKTLSKITGAEVWVKFENLQFTAAYKERGALNKLMLL 63 D+A I+AAA RL G RTP S L +I G V VK E LQ T ++K RG + L L Sbjct: 3 DIAMIEAAAARLAGHARRTPLLSSPFLDEIAGRRVLVKAECLQHTGSFKFRGGWSALSAL 62 Query: 64 SETEKQRGVIAASAGNHAQGLAYHGARLGVPVTIVMPKTTPFVKVQHTRDFGATVVIEGE 123 + +GVIA S+GNHAQG+A AR G P IVMP P +K+++TR GA VV+ Sbjct: 63 EPARRAQGVIAYSSGNHAQGVALAAARHGAPAVIVMPADAPQLKIENTRALGAEVVLYDR 122 Query: 124 TYDDANAHARKLRDEQGLTFVHPFDDYDIMAGQGTIALEMLEDAPDLEILPVPI----GG 179 +D +A +L DE+GLT + PFD+ ++AGQGT LE+ E A + + + GG Sbjct: 123 ATEDRDAIGARLADERGLTLIRPFDEPLVIAGQGTTGLEIAEQAAEEGVTSADVLTCCGG 182 Query: 180 GGLISGVATAAKALKPDIRIIGCEPAMYPS-----FTAKMRGVAAHCGGQTIAEGVAVKQ 234 GGL +G+A A +A P +R+ EP + ++R AA G +I + + Q Sbjct: 183 GGLTAGIALALEARAPGLRVRPVEPVGFDDTARSLAAGEIRSNAALSG--SICDAIVTPQ 240 Query: 235 VGELTYGVVRPLLDDVLLLEEPYLEQAVSLYCNVEKTIAEGAGAASLAALLAYPERFRGK 294 G +T+ ++ L L + + +A++L K + E GA +LAA L PE G Sbjct: 241 PGRITFPILARLCGPGLAVTDAEALRAMALAFLRLKIVLEPGGAVALAAALFRPEALDGD 300 Query: 295 KCGLILCGGNIDTRLLASVL 314 GGN+D L A L Sbjct: 301 AVICTASGGNVDPPLFARAL 320 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 325 Length adjustment: 29 Effective length of query: 371 Effective length of database: 296 Effective search space: 109816 Effective search space used: 109816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory