Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_011841935.1 RSPH17029_RS14500 aminotransferase class IV
Query= BRENDA::A0A0A0LJI6 (555 letters) >NCBI__GCF_000015985.1:WP_011841935.1 Length = 299 Score = 211 bits (536), Expect = 4e-59 Identities = 120/283 (42%), Positives = 162/283 (57%), Gaps = 2/283 (0%) Query: 259 NEKLLAWVGDEILPRDSAKVSVFDSVVQGGDSVWEGLRVYRGKIFKLDEHLDRLFDSSKA 318 NE + W+ ILPR A VSV+DS GD VWEG+R+Y G+ LDEHLDRLF+++ A Sbjct: 16 NETIRLWLNGRILPRAEALVSVYDSGFMLGDGVWEGIRLYDGRWAFLDEHLDRLFEAALA 75 Query: 319 LAFQNVPSREEVKDAIFRTLIRNGMFDNAHIRLSLTRGKKVTSGMSPQFNLYGCTLIVLA 378 + R ++ AI T NGM +AH RL +TRG K P + G T+ ++ Sbjct: 76 IDLDIGMDRAALRQAILDTAAANGMATDAHARLMVTRGVKTRPFQHPSLSRQGPTVAIIM 135 Query: 379 EWKPPVYDNSSGITLVTATTRRNSPNNLDSKIHHNNLLNNILAKIEGNNANAGDAIMLDK 438 E P I L T R P + D K++ ++ LN ILA I A A +A+MLD Sbjct: 136 EHSKPKIPRP--IRLATVPHIRGLPMSQDPKLNSHSKLNCILACIAAEKAGADEALMLDV 193 Query: 439 DGFVSETNATNIFLVKKGNVLTPHADYCLPGITRATVMDLVVKEKLILEERRISLSEFHT 498 GFV+ TNA N F+V+KG V T DYC+ GITR V+ + + + + E+ SL E ++ Sbjct: 194 HGFVNTTNACNFFIVRKGEVWTSTGDYCMNGITRGKVIRICREAGIPVFEKNFSLVETYS 253 Query: 499 ADEVWTTGTMGELTPVVKIDGRVIGDGQVGPVTRMLQNAYKKL 541 ADE + TGT G TPV IDGR IG G++GP+T L+ YK L Sbjct: 254 ADEAFLTGTFGAQTPVGSIDGRRIGTGEMGPMTERLRGLYKAL 296 Lambda K H 0.319 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 555 Length of database: 299 Length adjustment: 31 Effective length of query: 524 Effective length of database: 268 Effective search space: 140432 Effective search space used: 140432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_043828198.1 RSPH17029_RS14495 hypothetical protein
Query= BRENDA::A0A0A0LJI6 (555 letters) >NCBI__GCF_000015985.1:WP_043828198.1 Length = 240 Score = 164 bits (416), Expect = 3e-45 Identities = 92/232 (39%), Positives = 134/232 (57%), Gaps = 5/232 (2%) Query: 7 IHLWSTPRSLSTSLMYSFAQRDDMEVLDEPLYANFLRVTGYDRPYREELLSKMEPDGNKV 66 I +WS PR+LST++MYSFA R D + DEP YA +L+ TG D P R E+L+ E D + + Sbjct: 3 IAMWSGPRNLSTAMMYSFAARGDCGIWDEPFYAAYLKATGIDHPMRAEILAAHETDASVI 62 Query: 67 IKEIIF-APGEKKFRFCKHIAKQKVPGLASDLMKKGRHFILIRNPLDILPSYDKVIPA-S 124 AP + + KH+ +P M+ + LIR+P ++ SY K S Sbjct: 63 ADRCRGEAPLGEPIFYQKHMTLHMIPSFDRGFMRDCENVFLIRHPARVVASYAKKREGPS 122 Query: 125 FSELGFSELVSIYNELKE-LGRLPPIIDAAELQKNPEATLRGLCEELGIPFQHKMLKWEA 183 +++GF + +++E+ + LGR P ++D+A+++++PE TL LC LG+PF ML+W A Sbjct: 123 LADIGFVQQAELFDEVAQWLGRPPLVVDSADVRQDPEGTLTALCAALGLPFTEAMLRWPA 182 Query: 184 GPKAIDGVWAPWWYKTVHRSTAFEAPRKYPLPFPFNLY-DLLEQTIPLYNFL 234 G DGVWAP WY VH S+ FE P + PLP Y DL Q +P Y L Sbjct: 183 GGHKADGVWAPHWYGAVHLSSGFEDP-EGPLPDLAPHYADLARQALPHYERL 233 Lambda K H 0.319 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 555 Length of database: 240 Length adjustment: 29 Effective length of query: 526 Effective length of database: 211 Effective search space: 110986 Effective search space used: 110986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory