Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate WP_011842477.1 RSPH17029_RS18150 cystathionine beta-lyase
Query= reanno::Korea:Ga0059261_3194 (402 letters) >NCBI__GCF_000015985.1:WP_011842477.1 Length = 388 Score = 153 bits (386), Expect = 9e-42 Identities = 106/340 (31%), Positives = 167/340 (49%), Gaps = 15/340 (4%) Query: 63 MTYSRLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAFGS 122 + Y R PT LE + LE A+ SG++A++ L+ G H++ +A+G Sbjct: 52 LRYGRRGTPTTHALEDAVCALEKADRALLAPSGVSAISTILMSFAEPGAHILMTDSAYGP 111 Query: 123 CRWLTDTQLPKFGIETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIA 182 R + L +FG+ETT D IRP TK+ + E+P + T +V D+ A+ +A Sbjct: 112 ARKFCEFTLRRFGVETTYYDPTVGAGIEALIRPETKLIWMESPGSQTFEVQDVSAIAEVA 171 Query: 183 RERGIVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQGRVLAGAV-CGTEEF--INN 239 R GIVT +DN ++ +P+ G D+ + TK + G +L G + C E + + Sbjct: 172 RRHGIVTAIDNTWSGGYFCQPLTQGVDISIQAGTKYISGHSDLLLGTIACRAEHYDRLRE 231 Query: 240 TLLPFHRNTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVARFL--EGRVPRVNFPGL 297 T L F G + +A++ L+GL T+ +R+ E+ L+VA +L + V RV PGL Sbjct: 232 TYLRF----GVCVGADDAFLALRGLRTMAVRMAHHHESGLEVANWLLQQEEVCRVMHPGL 287 Query: 298 PSHPQHNLAMSQMAAAGPIFSIELDGGRTQAHG-LLDALGLIDISNNIGDSRSLMTHPAS 356 P P H L Q A +F + A G + D L L + ++ G SL+ P++ Sbjct: 288 PGDPGHALWQQQFTGASGLFGFVMRPVDRPALGRMFDGLSLFGMGSSWGGFESLLV-PSN 346 Query: 357 TTHSGVAEDQRLLMGVGEGMLRLNVGLEDPEDLIADLDQA 396 + A G +R++VGLEDP DLIA+L A Sbjct: 347 PSVYRTA----TTWTPGGQTVRIHVGLEDPADLIAELRAA 382 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 388 Length adjustment: 31 Effective length of query: 371 Effective length of database: 357 Effective search space: 132447 Effective search space used: 132447 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory