Align acetylornithine transaminase (EC 2.6.1.11); 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate WP_011868252.1 MMARC5_RS02450 acetylornithine transaminase
Query= BRENDA::B1XNF8 (418 letters) >NCBI__GCF_000016125.1:WP_011868252.1 Length = 395 Score = 374 bits (961), Expect = e-108 Identities = 193/394 (48%), Positives = 255/394 (64%), Gaps = 16/394 (4%) Query: 22 QYVMHTYGRFPVAIAKGEGCRLWDTEGKSYLDFVAGIATCTLGHAHPALIQAVSAQIQKL 81 +YV++TYGR PV + KG+G ++DTEGK Y DF+AGI +GH HP +++ + Q Q L Sbjct: 15 KYVINTYGRVPVVLVKGKGMSVFDTEGKEYFDFLAGIGVNNVGHCHPKVVETIKNQAQTL 74 Query: 82 HHISNLYYIPEQGALAQWIVEHSCADKVFFCNSGAEANEAAIKLVRKYAHTVSDFLEQPV 141 HISN+YY Q LA+ +V S DK FFCNSGAEANEAAIKL RKY ++ Sbjct: 75 IHISNIYYNVPQIELAKKLVNLSGLDKAFFCNSGAEANEAAIKLARKYGKKKG---KEGE 131 Query: 142 ILSAKSSFHGRTLATITATGQPKYQKHFDPLPDGFAYVPYNDIRALEEAITDIDEGNRRV 201 I++ + +FHGRTL T+TAT + KYQ+ F+PLP GF Y+P+NDI AL I++ + Sbjct: 132 IITMEHAFHGRTLTTVTATPKAKYQEGFEPLPQGFNYIPFNDIEALNAGISE------KT 185 Query: 202 AAIMLEALQGEGGVRPGDVEYFKAVRRICDENGILLVLDEVQVGVGRTGKYWGYENLGIE 261 AAIM+E +QGEGG+ P D EY KAVR++CDEN I+L+ DEVQ G+GRTG + YE G+ Sbjct: 186 AAIMIEPVQGEGGIHPADKEYLKAVRKLCDENNIVLIFDEVQCGMGRTGTMFSYEQYGVV 245 Query: 262 PDIFTSAKGLAGGIPIGAMMCKDSCA-VFNPGEHASTFGGNPFSCAAALAVVETLEQENL 320 PDI T AKGL GG PIGAM+ K A F PG H +TFGGNP +CA++ A ++ + L Sbjct: 246 PDIVTLAKGLGGGFPIGAMVAKSEIADAFTPGSHGTTFGGNPLACASSNAAIDVI--SGL 303 Query: 321 LENVNARGEQLRAGLKTLAEKYPYFSDVRGWGLINGMEIKADLELTSIEVVKAAMEKGLL 380 LEN GE R+ LK L EKY + +VR GL+ G+E L ++V EKG L Sbjct: 304 LENTLEMGEYFRSELKKLEEKYDFIKEVRSLGLMVGVE----LTFNGSDIVSKMFEKGFL 359 Query: 381 LAPAGPKVLRFVPPLIVSAAEINEAIALLDQTLA 414 + VLRF+PPLIV I+ I+ LD+ + Sbjct: 360 INCTSDTVLRFLPPLIVEKEHIDSIISALDEVFS 393 Lambda K H 0.319 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 395 Length adjustment: 31 Effective length of query: 387 Effective length of database: 364 Effective search space: 140868 Effective search space used: 140868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory