Align anthranilate synthase component I (EC 4.1.3.27) (characterized)
to candidate WP_011868356.1 MMARC5_RS02980 anthranilate synthase component I
Query= metacyc::MONOMER-281 (461 letters) >NCBI__GCF_000016125.1:WP_011868356.1 Length = 439 Score = 276 bits (706), Expect = 1e-78 Identities = 179/448 (39%), Positives = 250/448 (55%), Gaps = 28/448 (6%) Query: 13 DLETPVSTFMKVSRGEEFAFLLESVELGSAFGRHSFIGIGKKDVLVFEKGILRTSNQQLD 72 D P+ + + ++ +LES G R+++I + +L + N+ + Sbjct: 5 DYVNPLKLYGVLRDEGKYPVMLESRAKGQINARYTYISSNPEYMLRIGNKT-KMDNETIS 63 Query: 73 YTSSPLKAIKDWLEVYRYSVKHDELPSFRGGAVGFVSYDYI-SYIEKVKVKASVFPTFYF 131 S+P KA+K E ++ + K D F GG VG+++YD I +YI + SVF + Sbjct: 64 KESNPFKALK---ENFKITQKGDR---FTGGYVGYIAYDCIHNYIGGKIEEPSVFGYY-- 115 Query: 132 VVPEHLIIFDHLKNNVFIISDSPEELTSKVLSPFEEKPEKNVFVTEPESNFE-------R 184 +H+ ++DH N + S++ + EK KN + E + E Sbjct: 116 ---DHMYVYDHETRNFYYHSETNNSEELRNAEATVEKA-KNFKIEEEDGGIEVLGCDADL 171 Query: 185 EQFYKVVEKAKKYIVEGDIFQVVLSQAFTFKTTLDPFYIYRALRMINPSPYMFYLKFGDT 244 + + K+VEK K+YI GD FQVV S+ + K F +YR LR +NPSPYMF L+F D Sbjct: 172 DDYVKMVEKTKEYIYSGDAFQVVPSREYRLKNKFSAFQLYRNLRNVNPSPYMFLLEF-DK 230 Query: 245 VVLGSSPETMAKVEGDKATVKPIAGTRPRGRTVEEDLKLERELLNDEKEIAEHVMLVDLG 304 V+G+SPETMA V+ + V PIAGT P G+T E KL LL DEKE AEH+MLVDL Sbjct: 231 DVVGASPETMASVQNNILKVNPIAGTAPIGKTENETQKLAEMLLKDEKERAEHMMLVDLA 290 Query: 305 RNDLGRVCKEGTVRVEKKMVIERYSHVMHIVSQVSGELKDDKDAVDVFEATFPAGTVSGA 364 RND+ +V K G++ +E+ + RYSHV HI S+V G LKD+ D EA FPAGT++GA Sbjct: 291 RNDVRKVSKSGSIVLERFFDVVRYSHVQHIESEVLGTLKDNSTIFDAIEAAFPAGTLTGA 350 Query: 365 PKVRAMEIIEELEPTPRGPYAGAVGYFSFPDDKGRMNMDSAITIRSFFFKGKQGWLQAGA 424 PK RAMEII+E+E + R Y GAVGYFS N D AI IR ++AG Sbjct: 351 PKFRAMEIIDEVEKSRRKIYGGAVGYFS-----NSGNADLAIGIRMAEIDSVCR-VRAGG 404 Query: 425 GIVYDSVPEREYQETLNKLRALFRSLEV 452 G+V DSVPE EY ET K+ A+ ++L V Sbjct: 405 GVVADSVPENEYYETERKMAAMMKALGV 432 Lambda K H 0.319 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 439 Length adjustment: 33 Effective length of query: 428 Effective length of database: 406 Effective search space: 173768 Effective search space used: 173768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_011868356.1 MMARC5_RS02980 (anthranilate synthase component I)
to HMM TIGR01820 (trpE: anthranilate synthase component I (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01820.hmm # target sequence database: /tmp/gapView.30306.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01820 [M=449] Accession: TIGR01820 Description: TrpE-arch: anthranilate synthase component I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-160 519.7 4.9 8e-160 518.9 4.9 1.4 1 lcl|NCBI__GCF_000016125.1:WP_011868356.1 MMARC5_RS02980 anthranilate synt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016125.1:WP_011868356.1 MMARC5_RS02980 anthranilate synthase component I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 518.9 4.9 8e-160 8e-160 1 449 [] 9 431 .. 9 431 .. 0.97 Alignments for each domain: == domain 1 score: 518.9 bits; conditional E-value: 8e-160 TIGR01820 1 PlelykalrkeseysflLesvekqskkaryslvgaspeavvkinerkavelfeeivskvkklegkkkae 69 Pl+ly +lr+e +y+++Les k + +ary++++ +pe++++i ++ +k+++ lcl|NCBI__GCF_000016125.1:WP_011868356.1 9 PLKLYGVLRDEGKYPVMLESRAKGQINARYTYISSNPEYMLRIGNK-------------TKMDN----- 59 99*******************************************8.............67774..... PP TIGR01820 70 gkdvldalrkalkklkeielleeerqtflGglvGyvaYdavrdywedaekekeseipeaefllvtkvlv 138 +++++ ++++k+lke + +++ ++f+Gg vGy+aYd +++y+ ++ +e +++f ++++++v lcl|NCBI__GCF_000016125.1:WP_011868356.1 60 --ETISKESNPFKALKENFKITQKGDRFTGGYVGYIAYDCIHNYIGGKIEE------PSVFGYYDHMYV 120 ..78999999999999988888999***********************999......99********** PP TIGR01820 139 fdhleeevslvvteevsad..eaekiveklkeaekeeeekkeaeleslaekeefeeavekakekifeGd 205 +dh +++ ++ ++ ++s + +ae+ vek+k+ + eee++ ++l +a+ +++ ++vek+ke+i +Gd lcl|NCBI__GCF_000016125.1:WP_011868356.1 121 YDHETRNFYYHSETNNSEElrNAEATVEKAKNFKIEEEDGGIEVLGCDADLDDYVKMVEKTKEYIYSGD 189 *******8888876665546699*************99999999999999******************* PP TIGR01820 206 ifqvvlSrklelrldldplelYaklreiNPSPYmyllefgdraivGaSPEtlvrvekrtveinPiAGta 274 fqvv Sr+++l+ + + ++lY++lr++NPSPYm+llef d+ +vGaSPEt+ +v+++++++nPiAGta lcl|NCBI__GCF_000016125.1:WP_011868356.1 190 AFQVVPSREYRLKNKFSAFQLYRNLRNVNPSPYMFLLEF-DKDVVGASPETMASVQNNILKVNPIAGTA 257 ***************************************.***************************** PP TIGR01820 275 pRgkseeeDeelakelLsdeKerAEHvmLvDLaRNDvrkvsesgsvkvsefmkvlkyshvqHieSevvg 343 p gk+e+e ++la+ lL+deKerAEH+mLvDLaRNDvrkvs+sgs+ +++f++v++yshvqHieSev+g lcl|NCBI__GCF_000016125.1:WP_011868356.1 258 PIGKTENETQKLAEMLLKDEKERAEHMMLVDLARNDVRKVSKSGSIVLERFFDVVRYSHVQHIESEVLG 326 ********************************************************************* PP TIGR01820 344 tLkkeadafdalkAvfPAGtlsGaPKirAmeiieelEkepRgvYgGgvGyfslngdadlAiviRtalie 412 tLk++ + fda++A+fPAGtl+GaPK rAmeii+e+Ek++R++YgG+vGyfs g+adlAi iR+a+i+ lcl|NCBI__GCF_000016125.1:WP_011868356.1 327 TLKDNSTIFDAIEAAFPAGTLTGAPKFRAMEIIDEVEKSRRKIYGGAVGYFSNSGNADLAIGIRMAEID 395 ********************************************************************9 PP TIGR01820 413 kkklriqaGAGivaDSdPekEfeEterKmkavlkaig 449 + +r++aG G+vaDS+Pe+E++EterKm+a++ka+g lcl|NCBI__GCF_000016125.1:WP_011868356.1 396 -SVCRVRAGGGVVADSVPENEYYETERKMAAMMKALG 431 .89********************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (449 nodes) Target sequences: 1 (439 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.04 # Mc/sec: 4.46 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory