Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_011879623.1 hydroxyectoine utilization dehydratase EutB
Query= BRENDA::P9WG59 (360 letters) >NCBI__GCF_000016205.1:WP_011879623.1 Length = 323 Score = 78.2 bits (191), Expect = 3e-19 Identities = 80/272 (29%), Positives = 115/272 (42%), Gaps = 8/272 (2%) Query: 39 TPLIAATNLSKQTGCTIHLKVEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSA 98 TPL + LS + G +HLK+E L PTGSFK RG T A+ + A V+ ASTGN Sbjct: 23 TPLDGSAALSARLGVPVHLKLETLQPTGSFKLRGATNALAELAAQHVTRVVTASTGN-HG 81 Query: 99 SAAAYAARA-GITCAVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFP 157 A A+AARA GI V + + K+ GA+I+ + DD AR++ D Sbjct: 82 RAVAHAARAFGIEVTVCM-SSLVPANKVDAVAALGARIVIAGDSQDDAQAAARQLVRDEG 140 Query: 158 TISLVNSVNPVRIEGQKTAAFEIVDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLI 217 + + +P + GQ T EI++ L PD L V +G + + Sbjct: 141 YVYVPPFDDPRIVAGQATIGVEILEAL---PDAGTLVVPLSGGGLFSGVAFAAKAIRPSL 197 Query: 218 DKLPRMLGTQAAGAAPLVLGEPVSHPE--TIATAIRIGSPASWTSAVEAQQQSKGRFLAA 275 + + AA A + G PV E T+A ++ G E + + Sbjct: 198 AVIGVSMARGAAMHASIAAGHPVDVDERPTLADSLGGGIGLHNRYTFEMTRALIDEIVLL 257 Query: 276 SDEEILAAYHLVARVEGVFVEPASAASIAGLL 307 + I R E + VE A A IA LL Sbjct: 258 DEPAIARGIAHAYREERLVVEGAGAVGIAALL 289 Lambda K H 0.317 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 323 Length adjustment: 29 Effective length of query: 331 Effective length of database: 294 Effective search space: 97314 Effective search space used: 97314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory