Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate WP_011879826.1 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >NCBI__GCF_000016205.1:WP_011879826.1 Length = 387 Score = 294 bits (752), Expect = 3e-84 Identities = 153/379 (40%), Positives = 230/379 (60%), Gaps = 12/379 (3%) Query: 6 ILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEARGYI 65 +L +LVGF +V N ++ +IR YL+ +G+ ++ EG +++++ATIGP++ G Sbjct: 9 LLARLVGFATVSRDSNLAMIDFIRDYLDGYGVTSELFYNAEGTKASLYATIGPRDRSGIA 68 Query: 66 ISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRPL 125 +SGH DVVP WT +PFRL RLYGRGT DMKGF+A++LAAVP L A PL P+ Sbjct: 69 LSGHTDVVPVDGQAWTVEPFRLTERDGRLYGRGTADMKGFIASMLAAVPALVARPLHTPV 128 Query: 126 HLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGRS 185 HL LSYDEE GC GV M+ L +P +IGEPTG++ + HKGK A R V+G + Sbjct: 129 HLLLSYDEEIGCVGVRPMLEALAGREHRPRVCVIGEPTGLQPVLGHKGKLAMRCHVKGAA 188 Query: 186 GHSSRPDQGLNAIHGVAGVLTQAVAEADRLVGGPFEH---VFEPPYSSLQIGTVKGGQAV 242 HS+ G+NAI A ++ + + E + P EH F+PP+S++Q G + GG+A+ Sbjct: 189 CHSAYAPLGVNAIDYAAKLIAR-LGEIGAALARP-EHRDERFDPPFSTVQTGLISGGRAL 246 Query: 243 NIIPDSCEVEFEARAISGVDPAELLAPVRKTAEA-------LTTLGFEVEWQELSAYPAL 295 NI+P CE +FE RA+ D ++ + +++ A+ ++ Q L AYP L Sbjct: 247 NIVPAECEFDFEVRALPSFDAHDVPSQLQQYAQGELLPRMRAVQPDTDIRLQALGAYPGL 306 Query: 296 SLEPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYILI 355 + PD+ A L+ L+G +A V++GTE GLF AG+ ++CGPG + + HKPDE++ + Sbjct: 307 ATAPDSDAARLIAMLSGSDAFGTVAFGTEGGLFGAAGMPTVVCGPGSMDQGHKPDEFVTL 366 Query: 356 DELMACRAMVEALGARCTA 374 ++L C AM+ L + A Sbjct: 367 EQLHGCDAMLGRLVSHVAA 385 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 387 Length adjustment: 30 Effective length of query: 344 Effective length of database: 357 Effective search space: 122808 Effective search space used: 122808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011879826.1 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.8034.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-125 404.4 0.0 2.6e-125 404.2 0.0 1.0 1 lcl|NCBI__GCF_000016205.1:WP_011879826.1 acetylornithine deacetylase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016205.1:WP_011879826.1 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 404.2 0.0 2.6e-125 2.6e-125 3 365 .] 10 380 .. 8 380 .. 0.98 Alignments for each domain: == domain 1 score: 404.2 bits; conditional E-value: 2.6e-125 TIGR01892 3 lakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDvv 71 la+Lv+f +vs+ sn+++i++++dyl+ gv+ e +a+g +k l a+iGp++ ++g++lsGhtDvv lcl|NCBI__GCF_000016205.1:WP_011879826.1 10 LARLVGFATVSRDSNLAMIDFIRDYLDGYGVTSELFYNAEG-TKASLYATIGPRD-RSGIALSGHTDVV 76 899**************************************.************9.************* PP TIGR01892 72 PvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakk 140 Pvd++aWt +pfrLte+dgrLYgrGtaDmkGF+a +Laavp l a +L+ P+hl+ls+Dee+g+ G++ lcl|NCBI__GCF_000016205.1:WP_011879826.1 77 PVDGQAWTVEPFRLTERDGRLYGRGTADMKGFIASMLAAVPALVARPLHTPVHLLLSYDEEIGCVGVRP 145 ********************************************************************* PP TIGR01892 141 lieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlval 206 ++eala +rp++ ++GePt+l++v hkGk +++ +v+G hs+++ Gv+ai aakl+arl + lcl|NCBI__GCF_000016205.1:WP_011879826.1 146 MLEALAgreHRPRVCVIGEPTGLQPVLGHKGKLAMRCHVKGAACHSAYAPLGVNAIDYAAKLIARLGEI 214 ******9999*********************************************************** PP TIGR01892 207 adklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee... 271 l r e+ +e F+pp++t++ G + GG+a ni++a+Ce+ +e+R++p d +++ ++l++ a+ lcl|NCBI__GCF_000016205.1:WP_011879826.1 215 GAALARpEHRDERFDPPFSTVQTGLISGGRALNIVPAECEFDFEVRALPSFDAHDVPSQLQQYAQGell 283 ******88999***************************************************9998888 PP TIGR01892 272 ..vkekapgfevkveelsatpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvlGPG 337 +++ +p+++++ + l a+p+l++ +d+++++l++ l+G+ a +v++gte gl+ +G+++vv+GPG lcl|NCBI__GCF_000016205.1:WP_011879826.1 284 prMRAVQPDTDIRLQALGAYPGLATAPDSDAARLIAMLSGSdAFGTVAFGTEGGLFGAAGMPTVVCGPG 352 8889999*********************************9999************************* PP TIGR01892 338 didqahqpdeYveieelkrcrallerlv 365 ++dq h+pde+v +e+l+ c+a+l rlv lcl|NCBI__GCF_000016205.1:WP_011879826.1 353 SMDQGHKPDEFVTLEQLHGCDAMLGRLV 380 ************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (387 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.86 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory