Align Serine hydroxymethyltransferase; SHMT; Serine methylase; L-threonine/L-allo-threonine aldolase; EC 2.1.2.1; EC 4.1.2.48 (characterized)
to candidate WP_011881288.1 serine hydroxymethyltransferase
Query= SwissProt::D3DKC4 (427 letters) >NCBI__GCF_000016205.1:WP_011881288.1 Length = 415 Score = 512 bits (1319), Expect = e-150 Identities = 257/405 (63%), Positives = 315/405 (77%), Gaps = 1/405 (0%) Query: 6 NTDAEIYEAIVKEYERQFYHLELIASENFTSLAVMEAQGSVMTNKYAEGLPHKRYYGGCE 65 N D EI+ AI +E RQ H+ELIASEN+TS AVM AQGS +TNKYAEG P KRYYGGCE Sbjct: 11 NVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCE 70 Query: 66 FVDIAEDLAIERAKALFDAEHANVQPHSGTQANMAVYMAVLKPGDTIMGMDLSHGGHLTH 125 +VD+ E LAI+R K LF AE ANVQP+SG+QAN V+ A+LKPGDTIMGM L+HGGHLTH Sbjct: 71 YVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTH 130 Query: 126 GAKVNFSGKIYNAVYYGVHPETHLIDYDQLYRLAKEHKPKLIVGGASAYPRVIDWAKLRE 185 G+ VN SGK +N V YG++ E IDYD +LA+EHKPKLIV GASA+ ID+A++ + Sbjct: 131 GSPVNMSGKWFNVVSYGLN-ENEDIDYDAAEKLAQEHKPKLIVAGASAFALKIDFARMAQ 189 Query: 186 IADSVGAYLMVDMAHYAGLIAGGVYPNPVPYAHFVTSTTHKTLRGPRSGFILCKKEFAKD 245 IA SVGAYLMVDMAHYAGLIA GVYPNPVP+A FVT+TTHK+LRGPR G IL K E+ K Sbjct: 190 IAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKQ 249 Query: 246 IDKSVFPGIQGGPLMHVIAAKAVAFKEAMSQEFKEYARQVVANARVLAEEFIKEGFKVVS 305 I+ ++FPGIQGGPLMHVIAAKAVAFKEA+S EFK Y ++VV NARVLAE +K G ++VS Sbjct: 250 INSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKAYQQKVVENARVLAETLVKRGLRIVS 309 Query: 306 GGTDSHIVLLDLRDTGLTGREVEEALGKANITVNKNAVPFDPLPPVKTSGIRLGTPAMTT 365 G T+SH++L+DLR +TG+ E ALG A+ITVNKNA+P DP P TSG+RLG+PAMTT Sbjct: 310 GRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGVRLGSPAMTT 369 Query: 366 RGMKEDQMRIIARLISKVIKNIGDEKVIEYVRQEVIEMCEQFPLY 410 RG + + LI+ V++N D +E VR +V E+ ++FP+Y Sbjct: 370 RGFGPAEAEQVGNLIADVLENPEDAATLERVRAQVAELTKRFPVY 414 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 415 Length adjustment: 32 Effective length of query: 395 Effective length of database: 383 Effective search space: 151285 Effective search space used: 151285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory