Align 3-phosphoshikimate 1-carboxyvinyltransferase; EC 2.5.1.19; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS (uncharacterized)
to candidate WP_011882219.1 3-phosphoshikimate 1-carboxyvinyltransferase
Query= curated2:A0B7Z0 (421 letters) >NCBI__GCF_000016205.1:WP_011882219.1 Length = 460 Score = 229 bits (584), Expect = 1e-64 Identities = 161/429 (37%), Positives = 233/429 (54%), Gaps = 20/429 (4%) Query: 9 SISGTVCAPPSKSYTHRAVLITALSD-SGCVHRPLISADTRATISACDAFGADVKLRGDS 67 S+ G P SK T RA+L L+D + VH L +T A AC A GA + Sbjct: 15 SLKGYAVTPSSKPETQRAILAATLADGTSIVHNDLRCVETSAMKQACRALGARIDEHAGY 74 Query: 68 LEIQGVSGAPRTPENVIDVLNSGTTLRFMSAVAALTDG-AVLTGDSSIRSRPNGPLLKAL 126 LEI+GV A + V+D + SG R +A+ + D A++TGD+ +R+R PL AL Sbjct: 75 LEIRGVGRALHLGQRVVDAIGSGLVFRTFTALTSFADSPAIITGDTILRTRVMKPLFDAL 134 Query: 127 NELGAEAFSIRGNDRAPLVI-RGRLRGGSTSLDGSVSSQFLSALLIACPLSSGETTISIK 185 ELGA I +AP+V G LRGG ++ G+VSSQF++A+L A PL+ I+I+ Sbjct: 135 EELGARIECIGEAGKAPVVNWGGGLRGGRCTVPGNVSSQFITAILFAAPLADKPVEIAIE 194 Query: 186 GELKSRPYAEMTLDILRKAG--AEICTDGDIFRMRGGQSYRLAEYTVPGDFSSASYPLAA 243 GEL S Y T+ LR +G ++ D + R++ G +Y+ AEY + GD++S+SY + A Sbjct: 195 GELLSISYIRQTIATLRHSGIQVDVTDDFSLIRVQPG-NYQAAEYRIGGDYTSSSYLIGA 253 Query: 244 AALAGSATVEGLFPSR--QGDSAIVDILREMGAEVSWDMESGEVRV--SGADLRG-REID 298 AAL V G S QG+ AI+D+++ +G V +D E+ + S + L G E D Sbjct: 254 AALFPGTFVLGNLGSESLQGERAIIDVVQALGLSVHFDDTRNELTLVNSHSQLTGDYEFD 313 Query: 299 ASQTPDLVPTLAVLGAVAEGRTVIKNAEHVRHKETDRIHAMAVELKKMGANIRER----- 353 AS P++VPTLA +GA +G + R ++ RI AM EL KMG +I+ Sbjct: 314 ASDFPNIVPTLAAIGAYVKGTFRVVGGSITRLHKSPRIKAMVSELGKMGVDIKGLFKDGV 373 Query: 354 PDGLEIDG-GDLH--GADLHGYHDHRIVMALTLAGIVAGD-TRIDTAESVDVSYPGFFED 409 DG EI G G+ + G DL + DHRI M+L +A + A R++ V+ S+P FF Sbjct: 374 YDGFEIRGTGEPYPGGVDLSSWGDHRIFMSLFIASLRARQPNRLEGYRDVNCSFPDFFTQ 433 Query: 410 MRRLGANVR 418 LGA R Sbjct: 434 FEHLGAAYR 442 Lambda K H 0.316 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 35 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 460 Length adjustment: 32 Effective length of query: 389 Effective length of database: 428 Effective search space: 166492 Effective search space used: 166492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate WP_011882219.1 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.17445.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-94 302.2 0.0 3.3e-94 302.0 0.0 1.0 1 lcl|NCBI__GCF_000016205.1:WP_011882219.1 3-phosphoshikimate 1-carboxyviny Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016205.1:WP_011882219.1 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 302.0 0.0 3.3e-94 3.3e-94 5 414 .. 22 439 .. 18 440 .. 0.95 Alignments for each domain: == domain 1 score: 302.0 bits; conditional E-value: 3.3e-94 TIGR01356 5 ipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakveeekeelviegvgg.lkepeae 72 p+sK ++Ra+l+a La+g+++v+n L++ t a+ +a+r+lGa++ e+ + l i+gvg l+ +++ lcl|NCBI__GCF_000016205.1:WP_011882219.1 22 TPSSKPETQRAILAATLADGTSIVHNDLRCVETSAMKQACRALGARIDEHAGYLEIRGVGRaLHLGQRV 90 59**********************************************99*********9999999*** PP TIGR01356 73 ldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPlaisgp.l 140 +d+ sG ++R t++ ++a+++ ++tgd l+ R +++l +aL+elga+ie+ e+g++P++ g+ l lcl|NCBI__GCF_000016205.1:WP_011882219.1 91 VDAIGSGLVFRTFTALTSFADSPAIITGDTILRTRVMKPLFDALEELGARIECIGEAGKAPVVNWGGgL 159 **************************************************************9988889 PP TIGR01356 141 kggivelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgveveeede.rkiv 208 +gg ++ g++SsQ+++a+l+aapla+++v++ i+g +l+s +yi++t+++l++ g++v+++d+ + i+ lcl|NCBI__GCF_000016205.1:WP_011882219.1 160 RGGRCTVPGNVSSQFITAILFAAPLADKPVEIAIEG-ELLSISYIRQTIATLRHSGIQVDVTDDfSLIR 227 99*********************************9.***************************9**** PP TIGR01356 209 vkggqkykqkevevegDaSsAafflaaaaitgeevtvenlgenstqgdkaiiivLeemGadveveeqr. 276 v++g+ y+ e+++ gD+ s ++++ aaa+ +++ ++ nlg++s+qg++aii+v++++G +v+++++r lcl|NCBI__GCF_000016205.1:WP_011882219.1 228 VQPGN-YQAAEYRIGGDYTSSSYLIGAAALFPGTFVLGNLGSESLQGERAIIDVVQALGLSVHFDDTRn 295 ***98.88888*******************************************************999 PP TIGR01356 277 .dvevegasklkgvkvdidvdsliDelptlavlaafAegetriknieelRvkEsdRiaaiaeeLeklGv 344 + v+++s+l g + d++++++ +ptla+++a+ +g+ r+ + + R++ s Ri+a+++eL k+Gv lcl|NCBI__GCF_000016205.1:WP_011882219.1 296 eLTLVNSHSQLTGDY-EFDASDFPNIVPTLAAIGAYVKGTFRVVGGSITRLHKSPRIKAMVSELGKMGV 363 655566688886544.9**************************************************** PP TIGR01356 345 eveel.....edgllieGkk.kelkgavvdtydDHRiamalavlglaaegeveiedaecvaksfPeFfe 407 +++ l dg++i+G+ g +++++DHRi m+l +++l+a+++ ++e+ v+ sfP+Ff lcl|NCBI__GCF_000016205.1:WP_011882219.1 364 DIKGLfkdgvYDGFEIRGTGePYPGGVDLSSWGDHRIFMSLFIASLRARQPNRLEGYRDVNCSFPDFFT 432 **85322223899******8556666899**************************************** PP TIGR01356 408 vleqlga 414 e+lga lcl|NCBI__GCF_000016205.1:WP_011882219.1 433 QFEHLGA 439 **99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (460 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 13.03 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory