Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_011885205.1 inositol monophosphatase
Query= curated2:P56160 (259 letters) >NCBI__GCF_000016205.1:WP_011885205.1 Length = 267 Score = 117 bits (293), Expect = 2e-31 Identities = 83/266 (31%), Positives = 133/266 (50%), Gaps = 14/266 (5%) Query: 1 MTPDLQLALELAEKAGKLTLDYFGRRSL-----QVFSKRDDTPVTEADRNAEELIRQGIS 55 M P L +A++ A +AG++ R SL ++ K+ + VTE D+ AEE I + + Sbjct: 1 MHPMLNIAVKAARRAGQI----INRASLDLDLIEIRKKQQNDFVTEVDKAAEEAIIETLK 56 Query: 56 AKFPDDGLFGEEFDEHPSGNGRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVIN 115 +PD + EE E + + +WIIDP+DGT +FIHG P Y V IALE +G + V+ Sbjct: 57 TAYPDHAILAEESGESENESEFKWIIDPLDGTTNFIHGFPYYCVSIALEHKGVVTQAVVY 116 Query: 116 FPALGELYQAERGSGAFMNGSPVQV---SAIAENSAST-VVFTEKEYLLDPPSNHPVDQL 171 P +L+ A RG GA++N ++V +A+ T F EK+ LD + + Sbjct: 117 DPNRNDLFTATRGRGAYLNDRRIRVGRRDRLADALVGTGFPFREKDG-LDAYARLFTEMT 175 Query: 172 RIDAGLVRGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSI 231 + GL R VA+GR + ++ ++ WD AA ++ EAGG +Y G Sbjct: 176 QACTGLRRPGAAALDLANVAAGRLDAFFEQGINVWDMAAGSLLITEAGGLVGNYTGDADF 235 Query: 232 IDGEGLVSANNAMGRNLIAAIGNGER 257 + +V+AN + +I + R Sbjct: 236 LHRHEIVAANPKIYAQMIPILNRYSR 261 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 267 Length adjustment: 25 Effective length of query: 234 Effective length of database: 242 Effective search space: 56628 Effective search space used: 56628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory