Align Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 (characterized)
to candidate WP_011937976.1 GURA_RS05295 aspartate-semialdehyde dehydrogenase
Query= SwissProt::Q51344 (370 letters) >NCBI__GCF_000016745.1:WP_011937976.1 Length = 365 Score = 524 bits (1349), Expect = e-153 Identities = 262/368 (71%), Positives = 300/368 (81%), Gaps = 4/368 (1%) Query: 3 RVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSIDE 62 +VGLIGWRGMVGSVL+QRM EE DF IEPVFF+TS G P + LKDA I E Sbjct: 2 KVGLIGWRGMVGSVLLQRMQEENDFAGIEPVFFSTSQAGQPAP---MNAGTLKDASDIAE 58 Query: 63 LKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKVIDQA 122 LK LDVILTCQGGDYT + P+LR+ GWQGYWIDAAS+LRME +AVI+LDPVNR VID A Sbjct: 59 LKKLDVILTCQGGDYTKAIHPELRKTGWQGYWIDAASTLRMEPNAVIILDPVNRNVIDAA 118 Query: 123 LDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMGAA 182 L G +++IGGNCTVSLMLMALGGLF AGLVEW+++MTYQAASGAGA NMRELL QMG Sbjct: 119 LAKGQKDFIGGNCTVSLMLMALGGLFRAGLVEWITSMTYQAASGAGAPNMRELLSQMGVL 178 Query: 183 HASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPLGGSLIPWIDKELPNGQSREE 242 H SVA+ L NP+SAILDIDR+V TLRS+A PT+ FGAPL G+++PWID+E+ +GQSREE Sbjct: 179 HGSVAELLKNPSSAILDIDRQVTATLRSDALPTKEFGAPLAGNVLPWIDREVEDGQSREE 238 Query: 243 WKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHNPW 302 WK AETNKIL PIPVDGICVRV AMRCHSQALTIKLNKDVP+ DIE LI N W Sbjct: 239 WKGYAETNKILGT-TTPIPVDGICVRVSAMRCHSQALTIKLNKDVPIADIENLIKNDNQW 297 Query: 303 VKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPLRR 362 VK VPN + S+ LTPAAV+G+L+VP+GR+RK+ MG QYL AFT GDQLLWGAAEPLRR Sbjct: 298 VKFVPNTKADSLANLTPAAVSGSLTVPIGRVRKMKMGPQYLSAFTCGDQLLWGAAEPLRR 357 Query: 363 MLRILLER 370 MLR+LLE+ Sbjct: 358 MLRVLLEK 365 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 365 Length adjustment: 30 Effective length of query: 340 Effective length of database: 335 Effective search space: 113900 Effective search space used: 113900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011937976.1 GURA_RS05295 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01745.hmm # target sequence database: /tmp/gapView.4519.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01745 [M=366] Accession: TIGR01745 Description: asd_gamma: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-190 618.5 0.0 2e-190 618.3 0.0 1.0 1 lcl|NCBI__GCF_000016745.1:WP_011937976.1 GURA_RS05295 aspartate-semialdeh Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016745.1:WP_011937976.1 GURA_RS05295 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.3 0.0 2e-190 2e-190 1 366 [] 1 363 [. 1 363 [. 0.99 Alignments for each domain: == domain 1 score: 618.3 bits; conditional E-value: 2e-190 TIGR01745 1 kkvglvgwrgmvgsvllkrmqeekdfdaikpvffstsqlgqkapslakisailedaydidalkeldiii 69 +kvgl+gwrgmvgsvll+rmqee+df i+pvffstsq+gq ap+ a ++l+da di lk+ld+i+ lcl|NCBI__GCF_000016745.1:WP_011937976.1 1 MKVGLIGWRGMVGSVLLQRMQEENDFAGIEPVFFSTSQAGQPAPMNA---GTLKDASDIAELKKLDVIL 66 69******************************************866...57***************** PP TIGR01745 70 tcqggdytkeiypklrkagwkgywidaasslrmkddaviildpvnldvikdavnkgirtfvggnctvsl 138 tcqggdytk i+p+lrk+gw+gywidaas+lrm+ +aviildpvn +vi+ a++kg ++f+ggnctvsl lcl|NCBI__GCF_000016745.1:WP_011937976.1 67 TCQGGDYTKAIHPELRKTGWQGYWIDAASTLRMEPNAVIILDPVNRNVIDAALAKGQKDFIGGNCTVSL 135 ********************************************************************* PP TIGR01745 139 llmslgglfrdelvewvsvatyqaasgggarhmrellkqmgvlykeveeelakpssaileierkvtkls 207 +lm+lgglfr +lvew++++tyqaasg+ga mrell+qmgvl+++v+e l +pssail+i+r+vt + lcl|NCBI__GCF_000016745.1:WP_011937976.1 136 MLMALGGLFRAGLVEWITSMTYQAASGAGAPNMRELLSQMGVLHGSVAELLKNPSSAILDIDRQVTATL 204 ********************************************************************* PP TIGR01745 208 rseelpvenfsvplagslipwidkqldngqsreewkgqaetnkilgtkdtilvdglcvrigalrchsqa 276 rs+ lp+++f++plag+++pwid+++++gqsreewkg aetnkilgt++ i+vdg+cvr+ a+rchsqa lcl|NCBI__GCF_000016745.1:WP_011937976.1 205 RSDALPTKEFGAPLAGNVLPWIDREVEDGQSREEWKGYAETNKILGTTTPIPVDGICVRVSAMRCHSQA 273 ********************************************************************* PP TIGR01745 277 ltiklkkdvsleeieeiirahnkwvkvvpnereitlreltpaavtgtldipvgrlrklnmgkeylsaft 345 ltikl+kdv++ +ie++i+++n+wvk+vpn + ++l +ltpaav+g+l++p+gr+rk++mg++ylsaft lcl|NCBI__GCF_000016745.1:WP_011937976.1 274 LTIKLNKDVPIADIENLIKNDNQWVKFVPNTKADSLANLTPAAVSGSLTVPIGRVRKMKMGPQYLSAFT 342 ********************************************************************* PP TIGR01745 346 vgdqllwgaaeplrrmlrill 366 gdqllwgaaeplrrmlr+ll lcl|NCBI__GCF_000016745.1:WP_011937976.1 343 CGDQLLWGAAEPLRRMLRVLL 363 ******************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (366 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.11 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory