Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_011938377.1 GURA_RS07435 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000016745.1:WP_011938377.1 Length = 358 Score = 304 bits (778), Expect = 3e-87 Identities = 159/363 (43%), Positives = 237/363 (65%), Gaps = 6/363 (1%) Query: 1 MSEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWV 60 M + L LR IDSLD+R+L+L++ERA EV R+K S ++ F+ P RE + Sbjct: 1 MQKKKTLSDLRKEIDSLDDRMLELLNERASRVIEVGRLKAGS-----KSDFHVPSREREI 55 Query: 61 LKHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVI 120 + ++ N+GP ++ + +FREI+S+ LALE P++VA+ GP+ TF+ AA++ FG S Sbjct: 56 YERLIAQNRGPFPSQALKSVFREIISASLALEAPMKVAFFGPKATFTHMAAMQQFGLSAE 115 Query: 121 SKPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL 180 P +I VF EV G +GVVPVENSTEG V+HTLD F+E ++ + EV L IHH+L Sbjct: 116 LVPQKSIPAVFEEVEKGRALYGVVPVENSTEGMVSHTLDMFMESELKVNAEVLLEIHHYL 175 Query: 181 LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA 240 L T + + I ++ SH Q +AQCR WL + PNV V V+S A AA+ V ++ +AAIA Sbjct: 176 L-SRTGRMEDIKKVCSHQQPIAQCRNWLAENLPNVPVVDVASTAVAAQIVSEDYTAAAIA 234 Query: 241 GDMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELL 300 ++AA +Y L + E+IED+ N TRFLIIG + +GDDKTS++ S++++ G L+ +L Sbjct: 235 SELAASMYDLKVVRERIEDQVNNFTRFLIIGKKMAEKSGDDKTSLMFSVKDEVGILYHML 294 Query: 301 MPFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSY 360 PF GI+L++IE+RP + W Y+FF+D +GH DP+I ++++ +KVLGSY Sbjct: 295 EPFAKRGINLSKIESRPLKKKAWEYIFFLDLVGHISDPVIAEAVQELKGCCQFVKVLGSY 354 Query: 361 PKA 363 P+A Sbjct: 355 PRA 357 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 358 Length adjustment: 29 Effective length of query: 336 Effective length of database: 329 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 12 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory